Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	5606
Gene name	Mitogen-activated protein kinase kinase 3
Gene symbol	MAP2K3
Synonyms (NCBI Gene)	MAPKK3MEK3MKK3PRKMK3SAPKK-2SAPKK2
Chromosome	17
Chromosome location	17p11.2
Summary	The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphory

247

Show/Hide all (247)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005426	hsa-miR-214-3p	GFP reporter assayMicroarrayqRT-PCRWestern blot	19859982
MIRT005426	hsa-miR-214-3p	GFP reporter assayMicroarrayqRT-PCRWestern blot	19859982
MIRT006772	hsa-miR-20a-5p	Luciferase reporter assay	22696064
MIRT006772	hsa-miR-20a-5p	Luciferase reporter assay	22696064
MIRT006772	hsa-miR-20a-5p	Luciferase reporter assay	22696064
MIRT006772	hsa-miR-20a-5p	Luciferase reporter assay	22696064
MIRT006772	hsa-miR-20a-5p	Luciferase reporter assay	22696064
MIRT022960	hsa-miR-124-3p	Microarray	18668037
MIRT005426	hsa-miR-214-3p	Reporter assay;qRT-PCR;Microarray;Other	19859982
MIRT028553	hsa-miR-30a-5p	Proteomics	18668040
MIRT076343	hsa-miR-21-5p	ImmunohistochemistryLuciferase reporter assayWestern blot	24112539
MIRT076343	hsa-miR-21-5p	ImmunohistochemistryLuciferase reporter assayWestern blot	24112539
MIRT440289	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT144865	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT144866	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT440289	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT005426	hsa-miR-214-3p	PAR-CLIP	26701625
MIRT735289	hsa-miR-28-3p	qRT-PCR	32425976
MIRT736107	mmu-miR-21a-5p	Luciferase reporter assayFlow cytometry	31585536
MIRT1127959	hsa-miR-103a	CLIP-seq
MIRT1127960	hsa-miR-107	CLIP-seq
MIRT1127961	hsa-miR-1193	CLIP-seq
MIRT1127962	hsa-miR-1271	CLIP-seq
MIRT1127963	hsa-miR-1285	CLIP-seq
MIRT1127964	hsa-miR-1302	CLIP-seq
MIRT1127965	hsa-miR-15a	CLIP-seq
MIRT1127966	hsa-miR-15b	CLIP-seq
MIRT1127967	hsa-miR-16	CLIP-seq
MIRT1127968	hsa-miR-182	CLIP-seq
MIRT1127969	hsa-miR-1909	CLIP-seq
MIRT1127970	hsa-miR-195	CLIP-seq
MIRT1127971	hsa-miR-3122	CLIP-seq
MIRT1127972	hsa-miR-3136-3p	CLIP-seq
MIRT1127973	hsa-miR-3151	CLIP-seq
MIRT1127974	hsa-miR-3187-5p	CLIP-seq
MIRT1127975	hsa-miR-3614-5p	CLIP-seq
MIRT1127976	hsa-miR-3913-5p	CLIP-seq
MIRT1127977	hsa-miR-3943	CLIP-seq
MIRT1127978	hsa-miR-424	CLIP-seq
MIRT1127979	hsa-miR-4298	CLIP-seq
MIRT1127980	hsa-miR-4300	CLIP-seq
MIRT1127981	hsa-miR-4505	CLIP-seq
MIRT1127982	hsa-miR-4527	CLIP-seq
MIRT1127983	hsa-miR-4642	CLIP-seq
MIRT1127984	hsa-miR-4645-5p	CLIP-seq
MIRT1127985	hsa-miR-4673	CLIP-seq
MIRT1127986	hsa-miR-4688	CLIP-seq
MIRT1127987	hsa-miR-4708-3p	CLIP-seq
MIRT1127988	hsa-miR-486-3p	CLIP-seq
MIRT1127989	hsa-miR-497	CLIP-seq
MIRT1127990	hsa-miR-541	CLIP-seq
MIRT1127991	hsa-miR-612	CLIP-seq
MIRT1127992	hsa-miR-663b	CLIP-seq
MIRT1127993	hsa-miR-890	CLIP-seq
MIRT1127994	hsa-miR-9	CLIP-seq
MIRT1127995	hsa-miR-920	CLIP-seq
MIRT1127996	hsa-miR-96	CLIP-seq
MIRT1127997	hsa-miR-19a	CLIP-seq
MIRT1127998	hsa-miR-19b	CLIP-seq
MIRT1127999	hsa-miR-518a-5p	CLIP-seq
MIRT1128000	hsa-miR-527	CLIP-seq
MIRT1128001	hsa-miR-595	CLIP-seq
MIRT1128002	hsa-miR-648	CLIP-seq
MIRT1127965	hsa-miR-15a	CLIP-seq
MIRT1127966	hsa-miR-15b	CLIP-seq
MIRT1127967	hsa-miR-16	CLIP-seq
MIRT1127970	hsa-miR-195	CLIP-seq
MIRT1551116	hsa-miR-214	CLIP-seq
MIRT1127978	hsa-miR-424	CLIP-seq
MIRT1127989	hsa-miR-497	CLIP-seq
MIRT1551117	hsa-miR-708	CLIP-seq
MIRT2036343	hsa-miR-1262	CLIP-seq
MIRT2036344	hsa-miR-1286	CLIP-seq
MIRT1127964	hsa-miR-1302	CLIP-seq
MIRT2036345	hsa-miR-146b-3p	CLIP-seq
MIRT2036346	hsa-miR-199a-5p	CLIP-seq
MIRT2036347	hsa-miR-199b-5p	CLIP-seq
MIRT2036348	hsa-miR-21	CLIP-seq
MIRT2036349	hsa-miR-2392	CLIP-seq
MIRT2036350	hsa-miR-2467-3p	CLIP-seq
MIRT2036351	hsa-miR-3064-5p	CLIP-seq
MIRT1127971	hsa-miR-3122	CLIP-seq
MIRT1127973	hsa-miR-3151	CLIP-seq
MIRT2036352	hsa-miR-3169	CLIP-seq
MIRT2036353	hsa-miR-3170	CLIP-seq
MIRT2036354	hsa-miR-3173-5p	CLIP-seq
MIRT2036355	hsa-miR-3189-3p	CLIP-seq
MIRT2036356	hsa-miR-3192	CLIP-seq
MIRT2036357	hsa-miR-34a	CLIP-seq
MIRT2036358	hsa-miR-34c-5p	CLIP-seq
MIRT1127975	hsa-miR-3614-5p	CLIP-seq
MIRT2036359	hsa-miR-3652	CLIP-seq
MIRT2036360	hsa-miR-377	CLIP-seq
MIRT1127976	hsa-miR-3913-5p	CLIP-seq
MIRT1127977	hsa-miR-3943	CLIP-seq
MIRT2036361	hsa-miR-4287	CLIP-seq
MIRT2036362	hsa-miR-4292	CLIP-seq
MIRT2036363	hsa-miR-4294	CLIP-seq
MIRT1127979	hsa-miR-4298	CLIP-seq
MIRT1127980	hsa-miR-4300	CLIP-seq
MIRT2036364	hsa-miR-4302	CLIP-seq
MIRT2036365	hsa-miR-4313	CLIP-seq
MIRT2036366	hsa-miR-4323	CLIP-seq
MIRT2036367	hsa-miR-4326	CLIP-seq
MIRT2036368	hsa-miR-4430	CLIP-seq
MIRT2036369	hsa-miR-4469	CLIP-seq
MIRT2036370	hsa-miR-449a	CLIP-seq
MIRT2036371	hsa-miR-449b	CLIP-seq
MIRT1127981	hsa-miR-4505	CLIP-seq
MIRT2036372	hsa-miR-4515	CLIP-seq
MIRT2036373	hsa-miR-4640-5p	CLIP-seq
MIRT1127983	hsa-miR-4642	CLIP-seq
MIRT1127984	hsa-miR-4645-5p	CLIP-seq
MIRT1127985	hsa-miR-4673	CLIP-seq
MIRT2036374	hsa-miR-4676-5p	CLIP-seq
MIRT2036375	hsa-miR-4685-3p	CLIP-seq
MIRT2036376	hsa-miR-4691-5p	CLIP-seq
MIRT2036377	hsa-miR-4701-3p	CLIP-seq
MIRT2036378	hsa-miR-4726-5p	CLIP-seq
MIRT2036379	hsa-miR-4792	CLIP-seq
MIRT1127990	hsa-miR-541	CLIP-seq
MIRT2036380	hsa-miR-575	CLIP-seq
MIRT2036381	hsa-miR-590-5p	CLIP-seq
MIRT2036382	hsa-miR-596	CLIP-seq
MIRT2036383	hsa-miR-635	CLIP-seq
MIRT1128002	hsa-miR-648	CLIP-seq
MIRT1127992	hsa-miR-663b	CLIP-seq
MIRT2036384	hsa-miR-874	CLIP-seq
MIRT2036385	hsa-miR-885-3p	CLIP-seq
MIRT1127995	hsa-miR-920	CLIP-seq
MIRT2036386	hsa-miR-924	CLIP-seq
MIRT1127959	hsa-miR-103a	CLIP-seq
MIRT1127960	hsa-miR-107	CLIP-seq
MIRT1127961	hsa-miR-1193	CLIP-seq
MIRT2266582	hsa-miR-1202	CLIP-seq
MIRT2266583	hsa-miR-1245b-5p	CLIP-seq
MIRT2036343	hsa-miR-1262	CLIP-seq
MIRT1127963	hsa-miR-1285	CLIP-seq
MIRT2036344	hsa-miR-1286	CLIP-seq
MIRT2266584	hsa-miR-1291	CLIP-seq
MIRT2036345	hsa-miR-146b-3p	CLIP-seq
MIRT2266585	hsa-miR-1825	CLIP-seq
MIRT2266586	hsa-miR-1908	CLIP-seq
MIRT2266587	hsa-miR-1910	CLIP-seq
MIRT2036346	hsa-miR-199a-5p	CLIP-seq
MIRT2036347	hsa-miR-199b-5p	CLIP-seq
MIRT1127997	hsa-miR-19a	CLIP-seq
MIRT1127998	hsa-miR-19b	CLIP-seq
MIRT2036348	hsa-miR-21	CLIP-seq
MIRT1551116	hsa-miR-214	CLIP-seq
MIRT2036349	hsa-miR-2392	CLIP-seq
MIRT2036350	hsa-miR-2467-3p	CLIP-seq
MIRT2266588	hsa-miR-300	CLIP-seq
MIRT2266589	hsa-miR-3142	CLIP-seq
MIRT2036352	hsa-miR-3169	CLIP-seq
MIRT2036354	hsa-miR-3173-5p	CLIP-seq
MIRT1127974	hsa-miR-3187-5p	CLIP-seq
MIRT2036355	hsa-miR-3189-3p	CLIP-seq
MIRT2036357	hsa-miR-34a	CLIP-seq
MIRT2036358	hsa-miR-34c-5p	CLIP-seq
MIRT2266590	hsa-miR-3620	CLIP-seq
MIRT2266591	hsa-miR-3650	CLIP-seq
MIRT2266592	hsa-miR-381	CLIP-seq
MIRT2266593	hsa-miR-3926	CLIP-seq
MIRT1127977	hsa-miR-3943	CLIP-seq
MIRT2266594	hsa-miR-3972	CLIP-seq
MIRT2266595	hsa-miR-4264	CLIP-seq
MIRT2266596	hsa-miR-4271	CLIP-seq
MIRT2266597	hsa-miR-4291	CLIP-seq
MIRT2036362	hsa-miR-4292	CLIP-seq
MIRT2036364	hsa-miR-4302	CLIP-seq
MIRT2036365	hsa-miR-4313	CLIP-seq
MIRT2036366	hsa-miR-4323	CLIP-seq
MIRT2036367	hsa-miR-4326	CLIP-seq
MIRT2266598	hsa-miR-4493	CLIP-seq
MIRT2036370	hsa-miR-449a	CLIP-seq
MIRT2036371	hsa-miR-449b	CLIP-seq
MIRT1127981	hsa-miR-4505	CLIP-seq
MIRT2036372	hsa-miR-4515	CLIP-seq
MIRT2266599	hsa-miR-455-3p	CLIP-seq
MIRT2036373	hsa-miR-4640-5p	CLIP-seq
MIRT1127983	hsa-miR-4642	CLIP-seq
MIRT1127984	hsa-miR-4645-5p	CLIP-seq
MIRT2266600	hsa-miR-4666-3p	CLIP-seq
MIRT1127985	hsa-miR-4673	CLIP-seq
MIRT2036374	hsa-miR-4676-5p	CLIP-seq
MIRT2036376	hsa-miR-4691-5p	CLIP-seq
MIRT2266601	hsa-miR-4695-3p	CLIP-seq
MIRT2036377	hsa-miR-4701-3p	CLIP-seq
MIRT2266602	hsa-miR-4701-5p	CLIP-seq
MIRT1127987	hsa-miR-4708-3p	CLIP-seq
MIRT2266603	hsa-miR-4725-3p	CLIP-seq
MIRT2036378	hsa-miR-4726-5p	CLIP-seq
MIRT2266604	hsa-miR-4747-5p	CLIP-seq
MIRT2266605	hsa-miR-4755-3p	CLIP-seq
MIRT2266606	hsa-miR-4776-3p	CLIP-seq
MIRT2036379	hsa-miR-4792	CLIP-seq
MIRT1127999	hsa-miR-518a-5p	CLIP-seq
MIRT2266607	hsa-miR-520g	CLIP-seq
MIRT2266608	hsa-miR-520h	CLIP-seq
MIRT1128000	hsa-miR-527	CLIP-seq
MIRT2036380	hsa-miR-575	CLIP-seq
MIRT2266609	hsa-miR-581	CLIP-seq
MIRT2266610	hsa-miR-584	CLIP-seq
MIRT2266611	hsa-miR-588	CLIP-seq
MIRT2036381	hsa-miR-590-5p	CLIP-seq
MIRT1128001	hsa-miR-595	CLIP-seq
MIRT1127991	hsa-miR-612	CLIP-seq
MIRT2036383	hsa-miR-635	CLIP-seq
MIRT2266612	hsa-miR-644	CLIP-seq
MIRT2266613	hsa-miR-646	CLIP-seq
MIRT1128002	hsa-miR-648	CLIP-seq
MIRT2266614	hsa-miR-663	CLIP-seq
MIRT1127992	hsa-miR-663b	CLIP-seq
MIRT2266615	hsa-miR-665	CLIP-seq
MIRT2036384	hsa-miR-874	CLIP-seq
MIRT1127993	hsa-miR-890	CLIP-seq
MIRT2266616	hsa-miR-922	CLIP-seq
MIRT1127983	hsa-miR-4642	CLIP-seq
MIRT2036343	hsa-miR-1262	CLIP-seq
MIRT2036344	hsa-miR-1286	CLIP-seq
MIRT2266586	hsa-miR-1908	CLIP-seq
MIRT2036346	hsa-miR-199a-5p	CLIP-seq
MIRT2036347	hsa-miR-199b-5p	CLIP-seq
MIRT2036352	hsa-miR-3169	CLIP-seq
MIRT2036364	hsa-miR-4302	CLIP-seq
MIRT2036372	hsa-miR-4515	CLIP-seq
MIRT2036374	hsa-miR-4676-5p	CLIP-seq
MIRT2036377	hsa-miR-4701-3p	CLIP-seq
MIRT2036379	hsa-miR-4792	CLIP-seq
MIRT2036380	hsa-miR-575	CLIP-seq
MIRT1128002	hsa-miR-648	CLIP-seq
MIRT2266614	hsa-miR-663	CLIP-seq
MIRT2266582	hsa-miR-1202	CLIP-seq
MIRT2036343	hsa-miR-1262	CLIP-seq
MIRT2036344	hsa-miR-1286	CLIP-seq
MIRT2266584	hsa-miR-1291	CLIP-seq
MIRT2036345	hsa-miR-146b-3p	CLIP-seq
MIRT2266585	hsa-miR-1825	CLIP-seq
MIRT2266586	hsa-miR-1908	CLIP-seq
MIRT2036350	hsa-miR-2467-3p	CLIP-seq
MIRT2036352	hsa-miR-3169	CLIP-seq
MIRT2266594	hsa-miR-3972	CLIP-seq
MIRT2036372	hsa-miR-4515	CLIP-seq
MIRT2036377	hsa-miR-4701-3p	CLIP-seq
MIRT2266606	hsa-miR-4776-3p	CLIP-seq
MIRT2266614	hsa-miR-663	CLIP-seq

Show/Hide all (48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IBA
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004708	Function	MAP kinase kinase activity	IBA
GO:0004708	Function	MAP kinase kinase activity	IDA	8622669
GO:0004708	Function	MAP kinase kinase activity	IEA
GO:0004708	Function	MAP kinase kinase activity	TAS	7839144
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	11980910, 17255949, 19805025, 20067578, 20173330, 21044950, 21771788, 23602568, 31980649, 32707033, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	TAS	8622669
GO:0005829	Component	Cytosol	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	TAS	7839144
GO:0007507	Process	Heart development	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	11279118
GO:0031098	Process	Stress-activated protein kinase signaling cascade	IDA	35857590
GO:0031098	Process	Stress-activated protein kinase signaling cascade	IDA	8622669
GO:0031098	Process	Stress-activated protein kinase signaling cascade	IEA
GO:0035331	Process	Negative regulation of hippo signaling	IMP	27402810
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IMP	22696064
GO:0038066	Process	P38MAPK cascade	IEA
GO:0038066	Process	P38MAPK cascade	IMP	22696064
GO:0038066	Process	P38MAPK cascade	TAS
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IMP	22696064
GO:0045860	Process	Positive regulation of protein kinase activity	IDA	11980910
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	11980910
GO:0051604	Process	Protein maturation	IDA	32109412
GO:0060048	Process	Cardiac muscle contraction	IEA
GO:0070269	Process	Pyroptotic inflammatory response	IDA	32109412
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071493	Process	Cellular response to UV-B	IDA	35857590
GO:0072709	Process	Cellular response to sorbitol	IEA
GO:0090398	Process	Cellular senescence	IEA
GO:0090398	Process	Cellular senescence	TAS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1902531	Process	Regulation of intracellular signal transduction	IEA
GO:1904784	Process	NLRP1 inflammasome complex assembly	IDA	22665479

MIM	HGNC	e!Ensembl
602315	6843	ENSG00000034152

P46734

Protein name

Dual specificity mitogen-activated protein kinase kinase 3 (MAP kinase kinase 3) (MAPKK 3) (EC 2.7.12.2) (MAPK/ERK kinase 3) (MEK 3) (Stress-activated protein kinase kinase 2) (SAPK kinase 2) (SAPKK-2) (SAPKK2)

Protein function

Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38. Part of a signaling cascade that begins with the activati

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	64 → 325	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Abundant expression is seen in the skeletal muscle. It is also widely expressed in other tissues.

Sequence

MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS

Sequence length

347

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAP2K3-related disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTRICTIVE CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (59)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	31402118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	17980147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	22488549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	14695331, 14730602, 33483588	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	24480516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	18378158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	18378158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24233520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12377770, 15677464, 19245689, 32873298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24112539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24112539	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23912706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29696468		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31634561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31634561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31695024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29703930, 31695024, 31881903, 37713993	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	12601168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28109123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28109123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	24480516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30391783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30391783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroschisis	Gastroschisis	Pubtator	32163230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21132268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30894197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21132268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17012236, 30894197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17406030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	12601168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	12601168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	18614866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	24737428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	26149640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24112539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	11414763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24233520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30391783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30720101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23912706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29751559, 31695024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31634561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12377770		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31257538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	31257538	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28109123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	19245689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24112539, 24233520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	24480516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24530475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23825110, 28109123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	20955562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	18822283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma Choroid Plexus	Choroid plexus papilloma	Pubtator	29703930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paralysis	Paralysis	Pubtator	24737428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20168333	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	26119780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32873298	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MAP2K3 (mitogen-activated protein kinase kinase 3)