MALSU1 (mitochondrial assembly of ribosomal large subunit 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 115416
Gene name Mitochondrial assembly of ribosomal large subunit 1
Gene symbol MALSU1
Synonyms (NCBI Gene)
C7orf30mtRsfA
Chromosome 7
Chromosome location 7p15.3
miRNA miRNA information provided by mirtarbase database.
3
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT022482 hsa-miR-124-3p Microarray 18668037
MIRT030390 hsa-miR-24-3p Microarray 19748357
MIRT031558 hsa-miR-16-5p Proteomics 18668040
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14 Show/Hide all (14)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 28892042, 32296183, 32814053
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IDA 16548050, 22238376
GO:0005739 Component Mitochondrion IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
614624 21721 ENSG00000156928
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96EH3
Protein name Mitochondrial assembly of ribosomal large subunit protein 1
Protein function Required for normal mitochondrial ribosome function and mitochondrial translation (PubMed:22238375, PubMed:23171548). May play a role in ribosome biogenesis by preventing premature association of the 28S and 39S ribosomal subunits (Probable). In
PDB 5OOL , 5OOM , 7A5H , 7A5J , 7O9K , 7O9M , 7ODR , 7ODS , 7ODT , 7OF0 , 7OF2 , 7OF3 , 7OF5 , 7OF7 , 7OI6 , 7OI7 , 7OI8 , 7OI9 , 7OIC , 7OID , 7OIE , 7PD3 , 7PO4 , 7QH6 , 7QH7 , 8K2B , 8PK0 , 8QSJ , 8QU5
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02410 RsfS 95 → 194 Family
Sequence 
MGPGGRVARLLAPLMWRRAVSSVAGSAVGAEPGLRLLAVQRLPVGAAFCRACQTPNFVRG
LHSEPGLEERAEGTVNEGRPESDAADHTGPKFDIDMMVSLLRQENARDICVIQVPPEMRY
TDYFVIVSGTSTRHLHAMAFYVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLM
LPETREIYELEKLWTLRSYDDQLAQIAPETVPEDFILGIEDDTSSVTPVELKCE
Sequence length 234
Interactions View interactions

No strongly related genes found yet for MALSU1.

No additional diseases found yet through genes similar to MALSU1.