MAGEB5 (MAGE family member B5)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 347541
Gene name MAGE family member B5
Gene symbol MAGEB5
Synonyms (NCBI Gene)
CT3.3MAGE-B5
Chromosome X
Chromosome location Xp21.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300466 23795 ENSG00000188408
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BZ81
Protein name Melanoma-associated antigen B5 (Cancer/testis antigen 3.3) (CT3.3) (MAGE-B5 antigen)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01454 MAGE 105 → 215 MAGE family Family
Tissue specificity TISSUE SPECIFICITY: Expressed in testis. Not expressed in other normal tissues, but is expressed in tumors of different histological origins.
Sequence 
MTSAGVFNAGSDERANSRDEEYPCSSEVSPSTESSCSNFINIKVGLLEQFLLYKFKMKQR
ILKEDMLKIVNPRYQNQFAEIHRRASEHIEVVFAVDLKEVNPTCHLYDLVSKLKLPNNGR
IHVGKVLPKTGLLMTFLVVIFLKGNCANKEDTWKFLDMMQIYDGKKYYIYGEPRKLITQD
FVRLTYLEYHQVPCSYPAHYQFLWGPRAYTETSKMKVLEYLAKVNDIAPGAFSSQYEEAL
QDEEESPSQRCSRNWHYCSGQDCLRAKFSSFSQPY
Sequence length 275
Interactions View interactions

No strongly related genes found yet for MAGEB5.

No additional diseases found yet through genes similar to MAGEB5.