MAGEB3 (MAGE family member B3)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 4114
Gene name MAGE family member B3
Gene symbol MAGEB3
Synonyms (NCBI Gene)
CT3.5
Chromosome X
Chromosome location Xp21.2
Summary This gene is a MAGE-B subfamily member of the MAGE gene family. MAGE family member proteins direct the expression of tumor antigens recognized on a human melanoma by autologous cytolytic T lymphocytes. There are two known clusters of MAGE genes on chromos
miRNA miRNA information provided by mirtarbase database.
3
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT023642 hsa-miR-1-3p Microarray 18668037
MIRT1125666 hsa-miR-155 CLIP-seq
MIRT1125667 hsa-miR-365 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0005515 Function Protein binding IPI 28514442, 32814053, 33961781
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300152 6810 ENSG00000198798
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O15480
Protein name Melanoma-associated antigen B3 (MAGE-B3 antigen)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01454 MAGE 118 → 286 MAGE family Family
PF12440 MAGE_N 5 → 95 Melanoma associated antigen family N terminal Family
Tissue specificity TISSUE SPECIFICITY: Expressed in testis.
Sequence 
MPRGQKSTLHAREKRQQTRGQTQDHQGAQITATNKKKVSFSSPLILGATIQKKSAGRSRS
ALKKPQRALSTTTSVDVSYKKSYKGANSKIEKKQSFSQGLSSTVQSRTDPLIMKTNMLVQ
FLMEMYKMKKPIMKADMLKIVQKSHKNCFPEILKKASFNMEVVFGVDLKKVDSTKDSYVL
VSKMDLPNNGTVTRGRGFPKTGLLLNLLGVIFMKGNCATEEKIWEFLNKMRIYDGKKHFI
FGEPRKLITQDLVKLKYLEYRQVPNSNPARYEFLWGPRAHAETSKMKVLEFWAKVNKTVP
SAFQFWYEEALRDEEERVQAAAMLNDGSSAMGRKCSKAKASSSSHA
Sequence length 346
Interactions View interactions

No strongly related genes found yet for MAGEB3.

No additional diseases found yet through genes similar to MAGEB3.