MAGEB17 (MAGE family member B17)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 645864
Gene name MAGE family member B17
Gene symbol MAGEB17
Synonyms (NCBI Gene)
-
Chromosome X
Chromosome location Xp22.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300763 17418 ENSG00000182798
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A8MXT2
Protein name Melanoma-associated antigen B17
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01454 MAGE 116 → 284 MAGE family Family
PF12440 MAGE_N 5 → 93 Melanoma associated antigen family N terminal Family
Sequence 
MPRGQASKRRAREKRRQARGEDQCLGGAQATAAEKEKLPSSSSPACQSPPQSFPNAGIPQ
ESQRASYPSSPASAVSLTSSDEGAKGQKGESPNSFHGPSSSESTGRDLLNTKTGELVQFL
LNKYIRKEPITREAMLKVINRKYKQHFPEILRRSTENVEVVFGLYLKEMDPSRQSYVLVG
KLDFPNQGSLSDGGGFPLSGLLMVLLSTIFMHGNRATEEEMWECLNALGMYKGRKHFIYG
EPQELVTKDLVREGYLEYQQVPSSDPPRYEFLWGPRARAETSKMKVLEFVAKLNDTVAST
YKSRYEEALREEEEQARARAVARDSARARASRSFQP
Sequence length 336
Interactions View interactions

No strongly related genes found yet for MAGEB17.

No additional diseases found yet through genes similar to MAGEB17.