MAGEB16 (MAGE family member B16)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 139604
Gene name MAGE family member B16
Gene symbol MAGEB16
Synonyms (NCBI Gene)
-
Chromosome X
Chromosome location Xp21.1
miRNA miRNA information provided by mirtarbase database.
5
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2565295 hsa-miR-2116 CLIP-seq
MIRT2565296 hsa-miR-3908 CLIP-seq
MIRT2565297 hsa-miR-3942-5p CLIP-seq
MIRT2565298 hsa-miR-4703-5p CLIP-seq
MIRT2565299 hsa-miR-4766-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300762 21188 ENSG00000189023
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A2A368
Protein name Melanoma-associated antigen B16 (MAGE-B16 antigen)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01454 MAGE 189 → 288 MAGE family Family
PF12440 MAGE_N 5 → 107 Melanoma associated antigen family N terminal Family
Sequence 
MSQDQESPRCTHDQHLQTFSETQSLEVAQVSKALEKTLLSSSHPLVPGKLKEAPAAKAES
PLEVPQSFCSSSIAVTTTSSSESDEASSNQEEEDSPSSSEDTSDPRNVPADALDQKVAFL
VNFMLHKCQMKKPITKADMLKIIIKDDESHFSEILLRASEHLEMIFGLDVVEVDPTTHCY
GLFIKLGLTYDGMLSGEKGVPKTGLLIIVLGVIFMKGNRATEEEVWEVLNLTGVYSGKKH
FIFGEPRMLITKDFVKEKYLEYQQVANSDPARYEFLWGPRAKAETSKMKVLEFVAKVHGS
YPHSFPSQYAEALKEEEERARARI
Sequence length 324
Interactions View interactions

No strongly related genes found yet for MAGEB16.

No additional diseases found yet through genes similar to MAGEB16.