Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	4112
Gene name	MAGE family member B1
Gene symbol	MAGEB1
Synonyms (NCBI Gene)	CT3.1DAM10MAGE-XpMAGEL1
Chromosome	X
Chromosome location	Xp21.2
Summary	This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB gen

miRTarBase ID	miRNA	Experiments	Reference
MIRT018977	hsa-miR-335-5p	Microarray	18185580
MIRT1125653	hsa-miR-4635	CLIP-seq
MIRT1125654	hsa-miR-4686	CLIP-seq
MIRT1125655	hsa-miR-526b	CLIP-seq
MIRT2035514	hsa-miR-377	CLIP-seq

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0005634	Component	Nucleus	IBA

MIM	HGNC	e!Ensembl
300097	6808	ENSG00000214107

P43366

Protein name

Melanoma-associated antigen B1 (Cancer/testis antigen 3.1) (CT3.1) (DSS-AHC critical interval MAGE superfamily 10) (DAM10) (MAGE-B1 antigen) (MAGE-XP antigen)

PDB

6R7T

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01454	MAGE	115 → 283	MAGE family	Family
PF12440	MAGE_N	5 → 92	Melanoma associated antigen family N terminal	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed only in testis.

Sequence

MPRGQKSKLRAREKRRKAREETQGLKVAHATAAEKEECPSSSPVLGDTPTSSPAAGIPQK
PQGAPPTTTAAAAVSCTESDEGAKCQGEENASFSQATTSTESSVKDPVAWEAGMLMHFIL
RKYKMREPIMKADMLKVVDEKYKDHFTEILNGASRRLELVFGLDLKEDNPSGHTYTLVSK
LNLTNDGNLSNDWDFPRNGLLMPLLGVIFLKGNSATEEEIWKFMNVLGAYDGEEHLIYGE
PRKFITQDLVQEKYLKYEQVPNSDPPRYQFLWGPRAYAETTKMKVLEFLAKMNGATPRDF
PSHYEEALRDEEERAQVRSSVRARRRTTATTFRARSRAPFSRSSHPM

Sequence length

347

Interactions

View interactions

Related Genes Genes most often co-reported with MAGEB1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for MAGEB1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to MAGEB1 (see Related Genes above), that are NOT already directly curated for MAGEB1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to MAGEB1.

MAGEB1 (MAGE family member B1)

Save This Analysis