MAGEA13P (MAGE family member A13, pseudogene)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 139363
Gene name MAGE family member A13, pseudogene
Gene symbol MAGEA13P
Synonyms (NCBI Gene)
-
Chromosome X
Chromosome location Xq26.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 35154 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NCF6
Protein name Putative MAGE domain-containing protein MAGEA13P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12440 MAGE_N 5 → 98 Melanoma associated antigen family N terminal Family
Sequence 
MPHSQKSRHCELEQGLQAPKEAQGLVGVQVAEAEKVNTTASSSPSTLIQGTLEKVSASGT
PGTPQSSQRVCSPCTTIKATPWNQSDESSRSQEKKDPGASQALMLEKKVDELVKFLSVKY
TTKQPITEAEMLKGVIKEHKDHFPPIFMQAHECMEIVFGTDMKEVDPISHSCVLLKSLDL
TYDRRLSDDQGMPKTGLLILTFGVILMEANCASEEKIWEVLNIIRVYAGWKDFIYGEPRK
LITRDLVQEKYLECCQVSNSDPPRYKFPWGPRAHAETTKMKVLEFFSRVSGSDASSFPLL
YEEALRDEKEKAQAIIATMGGTTLMASAHSWAKSSSFSCPE
Sequence length 341
Interactions View interactions

No strongly related genes found yet for MAGEA13P.

No additional diseases found yet through genes similar to MAGEA13P.