Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	4111
Gene name	MAGE family member A12
Gene symbol	MAGEA12
Synonyms (NCBI Gene)	CT1.12MAGE12
Chromosome	X
Chromosome location	Xq28
Summary	This gene is closely related to several other genes clustered on chromosome X. These genes may be overexpressed in tumors. Multiple alternatively spliced variants encoding the same protein have been identified. [provided by RefSeq, Jun 2014]

8 Show/Hide all (8)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004109	hsa-miR-34a-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	21177782
MIRT004109	hsa-miR-34a-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	21177782
MIRT1125588	hsa-miR-3692	CLIP-seq
MIRT1125589	hsa-miR-4436b-5p	CLIP-seq
MIRT1125588	hsa-miR-3692	CLIP-seq
MIRT1125589	hsa-miR-4436b-5p	CLIP-seq
MIRT1125590	hsa-miR-4719	CLIP-seq
MIRT1125591	hsa-miR-513b	CLIP-seq

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 26871637, 31515488, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0042826	Function	Histone deacetylase binding	IBA

MIM	HGNC	e!Ensembl
300177	6799	ENSG00000213401

P43365

Protein name

Melanoma-associated antigen 12 (Cancer/testis antigen 1.12) (CT1.12) (MAGE-12 antigen) (MAGE12F antigen)

Protein function

Not known, though may play a role tumor transformation or progression. In vitro promotes cell viability in melanoma cell lines.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01454	MAGE	173 → 283	MAGE family	Family
PF12440	MAGE_N	5 → 96	Melanoma associated antigen family N terminal	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes.

Sequence

MPLEQRSQHCKPEEGLEAQGEALGLVGAQAPATEEQETASSSSTLVEVTLREVPAAESPS
PPHSPQGASTLPTTINYTLWSQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVHFL
LLKYRAREPFTKAEMLGSVIRNFQDFFPVIFSKASEYLQLVFGIEVVEVVRIGHLYILVT
CLGLSYDGLLGDNQIVPKTGLLIIVLAIIAKEGDCAPEEKIWEELSVLEASDGREDSVFA
HPRKLLTQDLVQENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLHHLLKISGGPHIS
YPPLHEWAFREGEE

Sequence length

314

Interactions

View interactions

Related Genes Genes most often co-reported with MAGEA12 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for MAGEA12.

Diseases Linked via Similar Genes Diseases curated for genes most similar to MAGEA12 (see Related Genes above), that are NOT already directly curated for MAGEA12 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to MAGEA12.

MAGEA12 (MAGE family member A12)

Save This Analysis