MAGEA11 (MAGE family member A11)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 4110
Gene name MAGE family member A11
Gene symbol MAGEA11
Synonyms (NCBI Gene)
CT1.11MAGE-11MAGE11MAGEA-11
Chromosome X
Chromosome location Xq28
Summary This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of thi
miRNA miRNA information provided by mirtarbase database.
5
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT030319 hsa-miR-26b-5p Microarray 19088304
MIRT2035460 hsa-miR-4700-3p CLIP-seq
MIRT2035460 hsa-miR-4700-3p CLIP-seq
MIRT2390464 hsa-miR-3591-3p CLIP-seq
MIRT2390465 hsa-miR-513b CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0005515 Function Protein binding IPI 16189514, 21516116, 25416956, 26871637, 31515488, 32296183, 32814053
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300344 6798 ENSG00000185247
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P43364
Protein name Melanoma-associated antigen 11 (Cancer/testis antigen 1.11) (CT1.11) (MAGE-11 antigen)
Protein function Acts as androgen receptor coregulator that increases androgen receptor activity by modulating the receptors interdomain interaction. May play a role in embryonal development and tumor transformation or aspects of tumor progression. {ECO:0000269|
PDB 6WJH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01454 MAGE 229 → 397 MAGE family Family
PF12440 MAGE_N 115 → 206 Melanoma associated antigen family N terminal Family
Tissue specificity TISSUE SPECIFICITY: Expressed in tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma. Expressed in testis, ovary, prostate, cancerous prostate, breast and adrenal tissue. {ECO:0000269|PubMe
Sequence 
METQFRRGGLGCSPASIKRKKKREDSGDFGLQVSTMFSEDDFQSTERAPYGPQLQWSQDL
PRVQVFREQANLEDRSPRRTQRITGGEQVLWGPITQIFPTVRPADLTRVIMPLEQRSQHC
KPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESF
SPTAMDAIFGSLSDEGSGSQEKEGPSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVK
GLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYD
GIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLT
QNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYED
ALREEGEGV
Sequence length 429
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
MAGEA11-related disorder Likely benign ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (18)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Neoplasms Breast neoplasm Pubtator 22198676 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Ovarian Epithelial Epithelial ovarian carcinoma Pubtator 23839233 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma BEFREE 23839233
★★★★★
★☆☆☆☆
Found in Text Mining only
Hepatitis C Hepatitis c Pubtator 35022469 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Hyperandrogenism Hyperandrogenism Pubtator 31256208 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of prostate Prostate cancer BEFREE 19372581, 28542476
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 19372581, 23839233
★★★★★
★☆☆☆☆
Found in Text Mining only
Osteosarcoma Osteosarcoma Pubtator 36807122 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Polycystic Ovary Syndrome Polycystic ovary syndrome Pubtator 31256208 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Polycystic Ovary Syndrome Polycystic Ovary Syndrome BEFREE 31256208
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for MAGEA11.

No additional diseases found yet through genes similar to MAGEA11.