MAGEA10 (MAGE family member A10)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 4109
Gene name MAGE family member A10
Gene symbol MAGEA10
Synonyms (NCBI Gene)
CT1.10MAGE10
Chromosome X
Chromosome location Xq28
Summary This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of thi
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005829 Component Cytosol IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300343 6797 ENSG00000124260
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P43363
Protein name Melanoma-associated antigen 10 (Cancer/testis antigen 1.10) (CT1.10) (MAGE-10 antigen)
Protein function Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.
PDB 7PBC , 7PDW , 7QPJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01454 MAGE 141 → 309 MAGE family Family
PF12440 MAGE_N 5 → 118 Melanoma associated antigen family N terminal Family
Tissue specificity TISSUE SPECIFICITY: Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for spermatogonia, spermatocytes and placenta. {ECO:0000269|PubMe
Sequence 
MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSS
SSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTL
QVLPDSESLPRSEIDEKVTDLVQFLLFKYQMKEPITKAEILESVIRNYEDHFPLLFSEAS
ECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILSIVFIEGYC
TPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP
RAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSS
ATGSFSYPE
Sequence length 369
Interactions View interactions

No strongly related genes found yet for MAGEA10.

No additional diseases found yet through genes similar to MAGEA10.