MAFIP (MAFF interacting protein)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 727764
Gene name MAFF interacting protein
Gene symbol MAFIP
Synonyms (NCBI Gene)
MIPTEKT4P4pp5644
Chromosome 14
Chromosome location -
Summary This gene was originally thought to be a protein coding gene. However, the encoded protein sequence is highly similar to the C-terminal sequence of the tektin-4 protein, and the transcript sequences of this gene are highly similar to the TEKT4 pseudogenes
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IEA
GO:0005730 Component Nucleolus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005929 Component Cilium IEA
GO:0060294 Process Cilium movement involved in cell motility IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 31102 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WZ33
Protein name MaFF-interacting protein (Tektin-4 like protein PP5644)
Protein function Acts as a coactivator of MAFF transcriptional activity. Inhibits cell growth and colony-forming efficiency.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03148 Tektin 43 → 115 Family
Tissue specificity TISSUE SPECIFICITY: Strongly expressed in brain, kidney and ovary. Moderately expressed in liver, spleen, thymus, prostate, testis, small intestine and colon. Weakly expressed in heart, placenta, lung and leukocytes. {ECO:0000269|PubMed:15881666}.
Sequence 
MLCPRAAFLVGSFHGVFPGPPASSHWEFWVPSTPVGAYFCPPQPQLTPPNTPKLVSEVEE
LYKSITALREKLLQAEQSLRNLKDIHMSLEKDVTAMTNSVFIDRQKCMAHRTCYPTILQL
AGYQ
Sequence length 124
Interactions View interactions

No strongly related genes found yet for MAFIP.

No additional diseases found yet through genes similar to MAFIP.