LYPD8 (LY6/PLAUR domain containing 8)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 646627
Gene name LY6/PLAUR domain containing 8
Gene symbol LYPD8
Synonyms (NCBI Gene)
-
Chromosome 1
Chromosome location 1q44
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA
GO:0005615 Component Extracellular space ISS
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
617067 44208 ENSG00000259823
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UX82
Protein name Ly6/PLAUR domain-containing protein 8
Protein function Secreted protein specifically required to prevent invasion of Gram-negative bacteria in the inner mucus layer of the colon epithelium, a portion of the large intestine which is free of commensal microbiota. Prevents invasion of flagellated micro
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00021 UPAR_LY6 125 → 203 u-PAR/Ly-6 domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the large intestine. Preferentially expressed on the epithelial layer exposed to the lumen (at protein level). {ECO:0000269|PubMed:27027293}.
Sequence 
MKGILVAGITAVLVAAVESLSCVQCNSWEKSCVNSIASECPSHANTSCISSSASSSLETP
VRLYQNMFCSAENCSEETHITAFTVHVSAEEHFHFVSQCCQGKECSNTSDALDPPLKNVS
SNAECPACYESNGTSCHGKPWKCYEEEQCVFLVAELKNDIESKSLVLKGCSNVSNATCQF
LSGENKTLGGVIFRKFECANVNSLTPTSAPTTSHNVGSKASLYLLALASLLLRGLLP
Sequence length 237
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Post-translational modification: synthesis of GPI-anchored proteins

No strongly related genes found yet for LYPD8.

No additional diseases found yet through genes similar to LYPD8.