LYPD2 (LY6/PLAUR domain containing 2)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 137797
Gene name LY6/PLAUR domain containing 2
Gene symbol LYPD2
Synonyms (NCBI Gene)
LYPDC2UNQ430
Chromosome 8
Chromosome location 8q24.3
miRNA miRNA information provided by mirtarbase database.
2
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT051141 hsa-miR-16-5p CLASH 23622248
MIRT2034759 hsa-miR-4508 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region TAS
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UXB3
Protein name Ly6/PLAUR domain-containing protein 2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00087 Toxin_TOLIP 23 → 100 Snake toxin and toxin-like protein Domain
Sequence 
MRGTRLALLALVLAACGELAPALRCYVCPEPTGVSDCVTIATCTTNETMCKTTLYSREIV
YPFQGDSTVTKSCASKCKPSDVDGIGQTLPVSCCNTELCNVDGAPALNSLHCGALTLLPL
LSLRL
Sequence length 125
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Post-translational modification: synthesis of GPI-anchored proteins

No strongly related genes found yet for LYPD2.

No additional diseases found yet through genes similar to LYPD2.