LYPD1 (LY6/PLAUR domain containing 1) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	116372
Gene name	LY6/PLAUR domain containing 1
Gene symbol	LYPD1
Synonyms (NCBI Gene)	LYPDC1PHTS
Chromosome	2
Chromosome location	2q21.2

13 Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT042635	hsa-miR-423-3p	CLASH	23622248
MIRT1123166	hsa-miR-1266	CLIP-seq
MIRT1123167	hsa-miR-1321	CLIP-seq
MIRT1123168	hsa-miR-1912	CLIP-seq
MIRT1123169	hsa-miR-3680	CLIP-seq
MIRT1123170	hsa-miR-4270	CLIP-seq
MIRT1123171	hsa-miR-4441	CLIP-seq
MIRT1123172	hsa-miR-4518	CLIP-seq
MIRT1123173	hsa-miR-4739	CLIP-seq
MIRT1123174	hsa-miR-4756-5p	CLIP-seq
MIRT1123175	hsa-miR-510	CLIP-seq
MIRT2034757	hsa-miR-4523	CLIP-seq
MIRT2034758	hsa-miR-4528	CLIP-seq

17 Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001662	Process	Behavioral fear response	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007271	Process	Synaptic transmission, cholinergic	IEA
GO:0016020	Component	Membrane	IEA
GO:0030550	Function	Acetylcholine receptor inhibitor activity	IBA
GO:0030550	Function	Acetylcholine receptor inhibitor activity	IEA
GO:0033130	Function	Acetylcholine receptor binding	IEA
GO:0035094	Process	Response to nicotine	IEA
GO:0045202	Component	Synapse	IEA
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0095500	Process	Acetylcholine receptor signaling pathway	IBA
GO:0095500	Process	Acetylcholine receptor signaling pathway	IEA
GO:0098552	Component	Side of membrane	IEA
GO:1903077	Process	Negative regulation of protein localization to plasma membrane	IEA

MIM	HGNC	e!Ensembl
610450	28431	ENSG00000150551

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q8N2G4
Protein name	Ly6/PLAUR domain-containing protein 1 (Putative HeLa tumor suppressor) (PHTS)
Protein function	Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro increases receptor desensitization and decreases affinity for ACh of alpha-4:beta-2-containing nAChRs. May play a role in the intracellular trafficki
PDB	6ZSS
Family and domains
Sequence	MWVLGIAATFCGLFLLPGFALQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVME QSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASA LRPGLRTTILFLKLALFSAHC
Sequence length	141
Interactions	View interactions

Reactome Pathway
Post-translational modification: synthesis of GPI-anchored proteins