LYG2 (lysozyme g2) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	254773
Gene name	Lysozyme g2
Gene symbol	LYG2
Synonyms (NCBI Gene)	LYGA2LYGHLYSG2
Chromosome	2
Chromosome location	2q11.2
Summary	The protein encoded by this gene contains a SLT domain, a protein domain present in bacterial lytic transglycosylase (SLT) and in eukaryotic lysozymes (GEWL). SLT domain catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (

14 Show/Hide all (14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1123081	hsa-miR-1202	CLIP-seq
MIRT1123082	hsa-miR-199a-5p	CLIP-seq
MIRT1123083	hsa-miR-199b-5p	CLIP-seq
MIRT1123084	hsa-miR-3613-5p	CLIP-seq
MIRT1123085	hsa-miR-3972	CLIP-seq
MIRT1123086	hsa-miR-4776-3p	CLIP-seq
MIRT1123087	hsa-miR-568	CLIP-seq
MIRT1123081	hsa-miR-1202	CLIP-seq
MIRT1123082	hsa-miR-199a-5p	CLIP-seq
MIRT1123083	hsa-miR-199b-5p	CLIP-seq
MIRT1123084	hsa-miR-3613-5p	CLIP-seq
MIRT1123085	hsa-miR-3972	CLIP-seq
MIRT1123086	hsa-miR-4776-3p	CLIP-seq
MIRT1123087	hsa-miR-568	CLIP-seq

13 Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003796	Function	Lysozyme activity	IBA
GO:0003796	Function	Lysozyme activity	IDA	21093056
GO:0003796	Function	Lysozyme activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IDA	21093056
GO:0005576	Component	Extracellular region	IEA
GO:0009253	Process	Peptidoglycan catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IEA
GO:0042742	Process	Defense response to bacterium	IDA	21093056
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	21093056

MIM	HGNC	e!Ensembl
616547	29615	ENSG00000185674

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q86SG7
Protein name	Lysozyme g-like protein 2 (EC 3.2.1.-)
Protein function	May act as a potent antibacterial protein that may play a role in the innate immunity.
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Strong expression detected in the eye and weak expression in the testis. No expression is observed in any other tissues. {ECO:0000269\|PubMed:21093056}.
Sequence	MLSSVVFWGLIALIGTSRGSYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMN CGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRG LKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFK SGIEAIATPSDIDNDFVNDIIARAKFYKRQSF
Sequence length	212
Interactions	View interactions