LY6L (lymphocyte antigen 6 family member L)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 101928108
Gene name Lymphocyte antigen 6 family member L
Gene symbol LY6L
Synonyms (NCBI Gene)
-
Chromosome 8
Chromosome location 8q24.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0016020 Component Membrane IEA
GO:0098552 Component Side of membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
H3BQJ8
Protein name Lymphocyte antigen 6L (Lymphocyte antigen 6 complex locus protein L)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00021 UPAR_LY6 30 → 109 u-PAR/Ly-6 domain Domain
Sequence 
MERLVLTLCTLPLAVASAGCATTPARNLSCYQCFKVSSWTECPPTWCSPLDQVCISNEVV
VSFKWSVRVLLSKRCAPRCPNDNMKFEWSPAPMVQGVITRRCCSWALCNRALTPQEGRWA
LRGGLLLQVGLSLLRALL
Sequence length 138
Interactions View interactions

No strongly related genes found yet for LY6L.

No additional diseases found yet through genes similar to LY6L.