LRRN2 (leucine rich repeat neuronal 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 10446
• Gene name: Leucine rich repeat neuronal 2
• Gene symbol: LRRN2
• Synonyms (NCBI Gene): FIGLER7, GAC1, LRANK1, LRRN5
• Chromosome: 1
• Chromosome location: 1q32.1
• Summary: The protein encoded by this gene belongs to the leucine-rich repeat superfamily. This gene was found to be amplified and overexpressed in malignant gliomas. The encoded protein has homology with other proteins that function as cell-adhesion molecules or a

miRNA Show/Hide all (70)

miRTarBase ID	miRNA	Experiments	Reference
MIRT039294	hsa-miR-671-5p	CLASH	23622248
MIRT1120942	hsa-miR-1273f	CLIP-seq
MIRT1120943	hsa-miR-1285	CLIP-seq
MIRT1120944	hsa-miR-1343	CLIP-seq
MIRT1120945	hsa-miR-143	CLIP-seq
MIRT1120946	hsa-miR-150	CLIP-seq
MIRT1120947	hsa-miR-205	CLIP-seq
MIRT1120948	hsa-miR-3187-5p	CLIP-seq
MIRT1120949	hsa-miR-3197	CLIP-seq
MIRT1120950	hsa-miR-324-5p	CLIP-seq
MIRT1120951	hsa-miR-3942-3p	CLIP-seq
MIRT1120952	hsa-miR-3945	CLIP-seq
MIRT1120953	hsa-miR-4253	CLIP-seq
MIRT1120954	hsa-miR-4663	CLIP-seq
MIRT1120955	hsa-miR-4708-5p	CLIP-seq
MIRT1120956	hsa-miR-4713-5p	CLIP-seq
MIRT1120957	hsa-miR-4770	CLIP-seq
MIRT1120958	hsa-miR-532-3p	CLIP-seq
MIRT1120959	hsa-miR-612	CLIP-seq
MIRT1120960	hsa-miR-642a	CLIP-seq
MIRT1120961	hsa-miR-3616-3p	CLIP-seq
MIRT1120962	hsa-miR-3669	CLIP-seq
MIRT1120963	hsa-miR-3689d	CLIP-seq
MIRT1120964	hsa-miR-3943	CLIP-seq
MIRT1120965	hsa-miR-4436b-3p	CLIP-seq
MIRT1120966	hsa-miR-4721	CLIP-seq
MIRT1120967	hsa-miR-515-5p	CLIP-seq
MIRT1120968	hsa-miR-548m	CLIP-seq
MIRT1120969	hsa-miR-642b	CLIP-seq
MIRT2034241	hsa-miR-4459	CLIP-seq
MIRT2264695	hsa-miR-1253	CLIP-seq
MIRT1120943	hsa-miR-1285	CLIP-seq
MIRT1120948	hsa-miR-3187-5p	CLIP-seq
MIRT2264696	hsa-miR-326	CLIP-seq
MIRT2264697	hsa-miR-330-5p	CLIP-seq
MIRT2264698	hsa-miR-378g	CLIP-seq
MIRT2264699	hsa-miR-4426	CLIP-seq
MIRT2264700	hsa-miR-4486	CLIP-seq
MIRT2264701	hsa-miR-4647	CLIP-seq
MIRT2264702	hsa-miR-4662b	CLIP-seq
MIRT1120954	hsa-miR-4663	CLIP-seq
MIRT1120959	hsa-miR-612	CLIP-seq
MIRT2264695	hsa-miR-1253	CLIP-seq
MIRT1120943	hsa-miR-1285	CLIP-seq
MIRT2453419	hsa-miR-3150a-3p	CLIP-seq
MIRT2453420	hsa-miR-3175	CLIP-seq
MIRT1120948	hsa-miR-3187-5p	CLIP-seq
MIRT2453421	hsa-miR-3612	CLIP-seq
MIRT2264698	hsa-miR-378g	CLIP-seq
MIRT2264699	hsa-miR-4426	CLIP-seq
MIRT2264700	hsa-miR-4486	CLIP-seq
MIRT2264701	hsa-miR-4647	CLIP-seq
MIRT2264702	hsa-miR-4662b	CLIP-seq
MIRT1120959	hsa-miR-612	CLIP-seq
MIRT2453422	hsa-miR-650	CLIP-seq
MIRT2453423	hsa-miR-939	CLIP-seq
MIRT2264695	hsa-miR-1253	CLIP-seq
MIRT1120943	hsa-miR-1285	CLIP-seq
MIRT2453419	hsa-miR-3150a-3p	CLIP-seq
MIRT2453420	hsa-miR-3175	CLIP-seq
MIRT1120948	hsa-miR-3187-5p	CLIP-seq
MIRT2453421	hsa-miR-3612	CLIP-seq
MIRT2264698	hsa-miR-378g	CLIP-seq
MIRT2264699	hsa-miR-4426	CLIP-seq
MIRT2264700	hsa-miR-4486	CLIP-seq
MIRT2264701	hsa-miR-4647	CLIP-seq
MIRT2264702	hsa-miR-4662b	CLIP-seq
MIRT1120959	hsa-miR-612	CLIP-seq
MIRT2453422	hsa-miR-650	CLIP-seq
MIRT2453423	hsa-miR-939	CLIP-seq

Gene ontology (GO) Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IBA
GO:0007155	Process	Cell adhesion	TAS	9662332
GO:0007165	Process	Signal transduction	TAS	9662332
GO:0016020	Component	Membrane	IEA
GO:0038023	Function	Signaling receptor activity	IBA
GO:0038023	Function	Signaling receptor activity	TAS	9662332

Other IDs

• MIM: 605492
• HGNC: 16914
• e!Ensembl: ENSG00000170382

Protein

• UniProt ID: O75325
• Protein name: Leucine-rich repeat neuronal protein 2 (Glioma amplified on chromosome 1 protein) (Leucine-rich repeat neuronal protein 5)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07679	I-set	427 → 514	Immunoglobulin I-set domain	Domain
  PF13855	LRR_8	93 → 153	Leucine rich repeat	Repeat
  PF13855	LRR_8	117 → 177	Leucine rich repeat	Repeat
  PF13855	LRR_8	310 → 371	Leucine rich repeat	Repeat
  PF13855	LRR_8	213 → 273	Leucine rich repeat	Repeat
  PF13855	LRR_8	69 → 129	Leucine rich repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Overamplified in malignant gliomas.
• Sequence:

  MRLLVAPLLLAWVAGATAAVPVVPWHVPCPPQCACQIRPWYTPRSSYREATTVDCNDLFL
  TAVPPALPAGTQTLLLQSNSIVRVDQSELGYLANLTELDLSQNSFSDARDCDFHALPQLL
  SLHLEENQLTRLEDHSFAGLASLQELYLNHNQLYRIAPRAFSGLSNLLRLHLNSNLLRAI
  DSRWFEMLPNLEILMIGGNKVDAILDMNFRPLANLRSLVLAGMNLREISDYALEGLQSLE
  SLSFYDNQLARVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS
  IDKFALVNLPELTKLDITNNPRLSFIHPRAFHHLPQMETLMLNNNALSALHQQTVESLPN
  LQEVGLHGNPIRCDCVIRWANATGTRVRFIEPQSTLCAEPPDLQRLPVREVPFREMTDHC
  LPLISPRSFPPSLQVASGESMVLHCRALAEPEPEIYWVTPAGLRLTPAHAGRRYRVYPEG
  TLELRRVTAEEAGLYTCVAQNLVGADTKTVSVVVGRALLQPGRDEGQGLELRVQETHPYH
  ILLSWVTPPNTVSTNLTWSSASSLRGQGATALARLPRGTHSYNITRLLQATEYWACLQVA
  FADAHTQLACVWARTKEATSCHRALGDRPGLIAILALAVLLLAAGLAAHLGTGQPRKGVG
  GRRPLPPAWAFWGWSAPSVRVVSAPLVLPWNPGRKLPRSSEGETLLPPLSQNS

• Sequence length: 713

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (15)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	34743297	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	34446935	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	40155373	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	32341527	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	33888516	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUMINAL A BREAST CARCINOMA	—	GWAS catalog	38832928	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	34594039, 38538606, 38632662	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	33290408, 34594039, 38538606, 38632662	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	26198764, 31374203, 35396580	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	34446935	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIPLE-NEGATIVE BREAST CANCER	—	GWAS catalog	38832928	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	33290408, 35551307, 38374256, 38685053	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	33667223	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	40050615	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (10)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	9662332		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	24679734		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	16319692		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	9662332		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	9662332		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	9662332		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10626796, 11281459		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	18753359		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	18753359		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

BIRC6 2 shared diseasesHemorrhoid, Upper aerodigestive tract neoplasm 2 shared evidence sourcesGWAS catalog (Hemorrhoid), GWAS catalog (Upper aerodigestive tract neoplasm) Related via 2 shared diseases including Hemorrhoid, Upper aerodigestive tract neoplasm — evidence mostly GWAS catalog. ABHD8 2 shared diseasesTriple negative breast cancer, Upper aerodigestive tract neoplasm 2 shared evidence sourcesGWAS catalog (Triple negative breast cancer), GWAS catalog (Upper aerodigestive tract neoplasm) Related via 2 shared diseases including Triple negative breast cancer, Upper aerodigestive tract neoplasm — evidence mostly GWAS catalog. ANKLE1 2 shared diseasesTriple negative breast cancer, Upper aerodigestive tract neoplasm 2 shared evidence sourcesGWAS catalog (Triple negative breast cancer), GWAS catalog (Upper aerodigestive tract neoplasm) Related via 2 shared diseases including Triple negative breast cancer, Upper aerodigestive tract neoplasm — evidence mostly GWAS catalog. POGLUT3 1 shared diseaseTriple negative breast cancer 2 shared evidence sourcesGWAS catalog (Melanoma), GWAS catalog (Triple negative breast cancer) Related via 1 shared disease including Triple negative breast cancer — evidence mostly GWAS catalog. ITGB6 2 shared diseasesHemorrhoid, Upper aerodigestive tract neoplasm 2 shared evidence sourcesGWAS catalog (Hemorrhoid), GWAS catalog (Upper aerodigestive tract neoplasm) Related via 2 shared diseases including Hemorrhoid, Upper aerodigestive tract neoplasm — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
BIRC6	2	["Hemorrhoid","Upper aerodigestive tract neoplasm"]	0	[]	2	["GWAS catalog (Hemorrhoid)","GWAS catalog (Upper aerodigestive tract neoplasm)"]
ABHD8	2	["Triple negative breast cancer","Upper aerodigestive tract neoplasm"]	0	[]	2	["GWAS catalog (Triple negative breast cancer)","GWAS catalog (Upper aerodigestive tract neoplasm)"]
ANKLE1	2	["Triple negative breast cancer","Upper aerodigestive tract neoplasm"]	0	[]	2	["GWAS catalog (Triple negative breast cancer)","GWAS catalog (Upper aerodigestive tract neoplasm)"]
POGLUT3	1	["Triple negative breast cancer"]	0	[]	2	["GWAS catalog (Melanoma)","GWAS catalog (Triple negative breast cancer)"]
ITGB6	2	["Hemorrhoid","Upper aerodigestive tract neoplasm"]	0	[]	2	["GWAS catalog (Hemorrhoid)","GWAS catalog (Upper aerodigestive tract neoplasm)"]

Diseases Linked via Similar Genes

Estrogen-receptor negative breast cancer Linked via 3 of 5 related genesABHD8, ANKLE1, POGLUT3 Gout Linked via 2 of 5 related genesBIRC6, ITGB6 Basal cell carcinoma Linked via 2 of 5 related genesABHD8, ANKLE1 Essential tremor Linked via 2 of 5 related genesABHD8, ANKLE1 Ovarian cancer Linked via 2 of 5 related genesABHD8, ANKLE1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Estrogen-receptor negative breast cancer	3	["ABHD8","ANKLE1","POGLUT3"]
Gout	2	["BIRC6","ITGB6"]
Basal cell carcinoma	2	["ABHD8","ANKLE1"]
Essential tremor	2	["ABHD8","ANKLE1"]
Ovarian cancer	2	["ABHD8","ANKLE1"]