LRRC52 (leucine rich repeat containing 52)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 440699
• Gene name: Leucine rich repeat containing 52
• Gene symbol: LRRC52
• Synonyms (NCBI Gene): -
• Chromosome: 1
• Chromosome location: 1q24.1

Gene ontology (GO) Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005249	Function	Voltage-gated potassium channel activity	IBA
GO:0005249	Function	Voltage-gated potassium channel activity	IDA	22547800
GO:0005267	Function	Potassium channel activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS	22547800
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	IBA
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	22547800
GO:0008076	Component	Voltage-gated potassium channel complex	IEA
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0044325	Function	Transmembrane transporter binding	IBA
GO:0044325	Function	Transmembrane transporter binding	IEA
GO:0044325	Function	Transmembrane transporter binding	IPI	22547800
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IDA	22547800
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0099104	Function	Potassium channel activator activity	IBA
GO:0099104	Function	Potassium channel activator activity	IDA	22547800
GO:0099104	Function	Potassium channel activator activity	IEA
GO:1903818	Process	Positive regulation of voltage-gated potassium channel activity	IDA	22547800

Other IDs

• MIM: 615218
• HGNC: 32156
• e!Ensembl: ENSG00000162763

Protein

• UniProt ID: Q8N7C0
• Protein name: Leucine-rich repeat-containing protein 52 (BK channel auxiliary gamma subunit LRRC52)
• Protein function: Auxiliary protein of the large-conductance, voltage and calcium-activated potassium channel (BK alpha). Modulates gating properties by producing a marked shift in the BK channel's voltage dependence of activation in the hyperpolarizing direction
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01462	LRRNT	25 → 52	Leucine rich repeat N-terminal domain	Family
  PF13855	LRR_8	77 → 136	Leucine rich repeat	Repeat
  PF13855	LRR_8	127 → 185	Leucine rich repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Mainly expressed in testis and skeletal muscle. {ECO:0000269|PubMed:22547800}.
• Sequence:

  MSLASGPGPGWLLFSFGMGLVSGSKCPNNCLCQAQEVICTGKQLTEYPLDIPLNTRRLFL
  NENRITSLPAMHLGLLSDLVYLDCQNNRIREVMDYTFIGVFKLIYLDLSSNNLTSISPFT
  FSVLSNLVQLNIANNPHLLSLHKFTFANTTSLRYLDLRNTGLQTLDSAALYHLTTLETLF
  LSGNPWKCNCSFLDFAIFLIVFHMDPSDDLNATCVEPTELTGWPITRVGNPLRYMCITHL
  DHKDYIFLLLIGFCIFAAGTVAAWLTGVCAVLYQNTRHKSSEEDEDEAGTRVEVSRRIFQ
  TQTSSVQEFPQLI

• Sequence length: 313

Related Genes

No strongly related genes found yet for LRRC52.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to LRRC52.