LRRC4B (leucine rich repeat containing 4B)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 94030
• Gene name: Leucine rich repeat containing 4B
• Gene symbol: LRRC4B
• Synonyms (NCBI Gene): HSM, LRIG4, NGL-3
• Chromosome: 19
• Chromosome location: 19q13.33

miRNA Show/Hide all (71)

miRTarBase ID	miRNA	Experiments	Reference
MIRT485888	hsa-miR-211-3p	PAR-CLIP	23592263
MIRT485886	hsa-miR-6850-3p	PAR-CLIP	23592263
MIRT485887	hsa-miR-4468	PAR-CLIP	23592263
MIRT485885	hsa-miR-6081	PAR-CLIP	23592263
MIRT485888	hsa-miR-211-3p	PAR-CLIP	23592263
MIRT485886	hsa-miR-6850-3p	PAR-CLIP	23592263
MIRT485887	hsa-miR-4468	PAR-CLIP	23592263
MIRT485885	hsa-miR-6081	PAR-CLIP	23592263
MIRT1119761	hsa-miR-1538	CLIP-seq
MIRT1119762	hsa-miR-2278	CLIP-seq
MIRT1119763	hsa-miR-3202	CLIP-seq
MIRT1119764	hsa-miR-3960	CLIP-seq
MIRT740008	hsa-miR-4287	CLIP-seq
MIRT1119765	hsa-miR-4308	CLIP-seq
MIRT1119766	hsa-miR-4467	CLIP-seq
MIRT1119767	hsa-miR-4533	CLIP-seq
MIRT740007	hsa-miR-4685-3p	CLIP-seq
MIRT1119768	hsa-miR-4745-3p	CLIP-seq
MIRT1119769	hsa-miR-4797-5p	CLIP-seq
MIRT1119770	hsa-miR-548a-5p	CLIP-seq
MIRT1119771	hsa-miR-548ab	CLIP-seq
MIRT1119772	hsa-miR-548ak	CLIP-seq
MIRT1119773	hsa-miR-548b-5p	CLIP-seq
MIRT1119774	hsa-miR-548c-5p	CLIP-seq
MIRT1119775	hsa-miR-548d-5p	CLIP-seq
MIRT1119776	hsa-miR-548h	CLIP-seq
MIRT1119777	hsa-miR-548i	CLIP-seq
MIRT1119778	hsa-miR-548j	CLIP-seq
MIRT1119779	hsa-miR-548k	CLIP-seq
MIRT1119780	hsa-miR-548l	CLIP-seq
MIRT1119781	hsa-miR-548w	CLIP-seq
MIRT1119782	hsa-miR-548y	CLIP-seq
MIRT1119783	hsa-miR-559	CLIP-seq
MIRT2390341	hsa-miR-1321	CLIP-seq
MIRT2390342	hsa-miR-1587	CLIP-seq
MIRT2390343	hsa-miR-3689a-3p	CLIP-seq
MIRT2390344	hsa-miR-3689c	CLIP-seq
MIRT2390345	hsa-miR-378g	CLIP-seq
MIRT2390346	hsa-miR-4417	CLIP-seq
MIRT2390347	hsa-miR-4419a	CLIP-seq
MIRT2390348	hsa-miR-4492	CLIP-seq
MIRT2390349	hsa-miR-4498	CLIP-seq
MIRT2390350	hsa-miR-4505	CLIP-seq
MIRT2390351	hsa-miR-4510	CLIP-seq
MIRT2390352	hsa-miR-4648	CLIP-seq
MIRT2390353	hsa-miR-4654	CLIP-seq
MIRT2390354	hsa-miR-4656	CLIP-seq
MIRT2390355	hsa-miR-4675	CLIP-seq
MIRT2390356	hsa-miR-4728-5p	CLIP-seq
MIRT2390357	hsa-miR-4739	CLIP-seq
MIRT2390358	hsa-miR-4741	CLIP-seq
MIRT2390359	hsa-miR-4756-5p	CLIP-seq
MIRT2390360	hsa-miR-4769-5p	CLIP-seq
MIRT2390361	hsa-miR-541	CLIP-seq
MIRT2390362	hsa-miR-654-5p	CLIP-seq
MIRT2390363	hsa-miR-762	CLIP-seq
MIRT2390341	hsa-miR-1321	CLIP-seq
MIRT2453362	hsa-miR-3141	CLIP-seq
MIRT2453363	hsa-miR-3616-3p	CLIP-seq
MIRT2390343	hsa-miR-3689a-3p	CLIP-seq
MIRT2390344	hsa-miR-3689c	CLIP-seq
MIRT2390347	hsa-miR-4419a	CLIP-seq
MIRT2453364	hsa-miR-4481	CLIP-seq
MIRT2390351	hsa-miR-4510	CLIP-seq
MIRT2453365	hsa-miR-4721	CLIP-seq
MIRT2390356	hsa-miR-4728-5p	CLIP-seq
MIRT2390357	hsa-miR-4739	CLIP-seq
MIRT2453366	hsa-miR-4745-5p	CLIP-seq
MIRT2390359	hsa-miR-4756-5p	CLIP-seq
MIRT2453367	hsa-miR-658	CLIP-seq
MIRT2453368	hsa-miR-765	CLIP-seq

Gene ontology (GO) Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042995	Component	Cell projection	IEA
GO:0044300	Component	Cerebellar mossy fiber	IEA
GO:0045202	Component	Synapse	IEA
GO:0051965	Process	Positive regulation of synapse assembly	IBA
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0051965	Process	Positive regulation of synapse assembly	ISS
GO:0098632	Function	Cell-cell adhesion mediator activity	IBA
GO:0098839	Component	Postsynaptic density membrane	IBA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IBA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099151	Process	Regulation of postsynaptic density assembly	IBA
GO:0099151	Process	Regulation of postsynaptic density assembly	IEA
GO:0099560	Process	Synaptic membrane adhesion	IBA
GO:0099560	Process	Synaptic membrane adhesion	IEA
GO:1905606	Process	Regulation of presynapse assembly	IBA
GO:1905606	Process	Regulation of presynapse assembly	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9NT99
• Protein name: Leucine-rich repeat-containing protein 4B (Netrin-G3 ligand) (NGL-3)
• Protein function: Synaptic adhesion protein. Regulates the formation of excitatory synapses. The trans-synaptic adhesion between LRRC4B and PTPRF regulates the formation of excitatory synapses in a bidirectional manner (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07679	I-set	364 → 453	Immunoglobulin I-set domain	Domain
  PF13855	LRR_8	86 → 146	Leucine rich repeat	Repeat
  PF13855	LRR_8	114 → 170	Leucine rich repeat	Repeat
  PF13855	LRR_8	137 → 190	Leucine rich repeat	Repeat
  PF13855	LRR_8	260 → 312	Leucine rich repeat	Repeat
  PF13855	LRR_8	224 → 265	Leucine rich repeat	Repeat

• Sequence:

  MARARGSPCPPLPPGRMSWPHGALLFLWLFSPPLGAGGGGVAVTSAAGGGSPPATSCPVA
  CSCSNQASRVICTRRDLAEVPASIPVNTRYLNLQENGIQVIRTDTFKHLRHLEILQLSKN
  LVRKIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAFNR
  VPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSGNR
  LDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFTPL
  HRLERVHLNHNPWHCNCDVLWLSWWLKETVPSNTTCCARCHAPAGLKGRYIGELDQSHFT
  CYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHDGT
  LNFTNVTVQDTGQYTCMVTNSAGNTTASATLNVSAVDPVAAGGTGSGGGGPGGSGGVGGG
  SGGYTYFTTVTVETLETQPGEEALQPRGTEKEPPGPTTDGVWGGGRPGDAAGPASSSTTA
  PAPRSSRPTEKAFTVPITDVTENALKDLDDVMKTTKIIIGCFVAITFMAAVMLVAFYKLR
  KQHQLHKHHGPTRTVEIINVEDELPAASAVSVAAAAAVASGGGVGGDSHLALPALERDHL
  NHHHYVAAAFKAHYSSNPSGGGCGGKGPPGLNSIHEPLLFKSGSKENVQETQI

• Sequence length: 713

Pathways

KEGG Pathway:

Cell adhesion molecules

Reactome Pathway:

Receptor-type tyrosine-protein phosphatases

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
COLORECTAL CANCER	—	GWAS catalog	38411962	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	35396580, 39753749	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	34313788	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

SLITRK1 2 shared pathwaysCell adhesion molecules, Receptor-type tyrosine-protein phosphatases Related via 2 shared pathways including Cell adhesion molecules, Receptor-type tyrosine-protein phosphatases. SLITRK4 2 shared pathwaysCell adhesion molecules, Receptor-type tyrosine-protein phosphatases Related via 2 shared pathways including Cell adhesion molecules, Receptor-type tyrosine-protein phosphatases. SLITRK3 2 shared pathwaysCell adhesion molecules, Receptor-type tyrosine-protein phosphatases Related via 2 shared pathways including Cell adhesion molecules, Receptor-type tyrosine-protein phosphatases. SLITRK5 2 shared pathwaysCell adhesion molecules, Receptor-type tyrosine-protein phosphatases Related via 2 shared pathways including Cell adhesion molecules, Receptor-type tyrosine-protein phosphatases. SLITRK6 2 shared pathwaysCell adhesion molecules, Receptor-type tyrosine-protein phosphatases Related via 2 shared pathways including Cell adhesion molecules, Receptor-type tyrosine-protein phosphatases.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SLITRK1	0	[]	2	["Cell adhesion molecules","Receptor-type tyrosine-protein phosphatases"]	0	[]
SLITRK4	0	[]	2	["Cell adhesion molecules","Receptor-type tyrosine-protein phosphatases"]	0	[]
SLITRK3	0	[]	2	["Cell adhesion molecules","Receptor-type tyrosine-protein phosphatases"]	0	[]
SLITRK5	0	[]	2	["Cell adhesion molecules","Receptor-type tyrosine-protein phosphatases"]	0	[]
SLITRK6	0	[]	2	["Cell adhesion molecules","Receptor-type tyrosine-protein phosphatases"]	0	[]

Diseases Linked via Similar Genes

Color vision deficiency Linked via 2 of 5 related genesSLITRK1, SLITRK6 Scoliosis Linked via 2 of 5 related genesSLITRK1, SLITRK6 Tourette syndrome Linked via 1 of 5 related genesSLITRK1 Hyperopia Linked via 1 of 5 related genesSLITRK1 Pancreatic cancer Linked via 1 of 5 related genesSLITRK1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Color vision deficiency	2	["SLITRK1","SLITRK6"]
Scoliosis	2	["SLITRK1","SLITRK6"]
Tourette syndrome	1	["SLITRK1"]
Hyperopia	1	["SLITRK1"]
Pancreatic cancer	1	["SLITRK1"]