LRRC39 (leucine rich repeat containing 39)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 127495
Gene name Leucine rich repeat containing 39
Gene symbol LRRC39
Synonyms (NCBI Gene)
-
Chromosome 1
Chromosome location 1p21.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 20847312
GO:0005737 Component Cytoplasm IEA
GO:0031430 Component M band IEA
GO:0035556 Process Intracellular signal transduction IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96DD0
Protein name Leucine-rich repeat-containing protein 39 (Myosin-interacting M-band-associated stress-responsive protein) (Myomasp)
Protein function Component of the sarcomeric M-band which plays a role in myocyte response to biomechanical stress. May regulate expression of other M-band proteins via an SRF-dependent pathway. Important for normal contractile function in heart. {ECO:0000250|Un
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 177 → 234 Leucine rich repeat Repeat
PF13855 LRR_8 83 → 141 Leucine rich repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Highly expressed in skeletal muscle and heart. Not detected in other tissues tested. {ECO:0000269|PubMed:20847312}.
Sequence 
MTENVVCTGAVNAVKEVWEKRIKKLNEDLKREKEFQHKLVRIWEERVSLTKLREKVTRED
GRVILKIEKEEWKTLPSSLLKLNQLQEWQLHRTGLLKIPEFIGRFQNLIVLDLSRNTISE
IPPGIGLLTRLQELILSYNKIKTVPKELSNCASLEKLELAVNRDICDLPQELSNLLKLTH
LDLSMNDFTTIPLAVLNMPALEWLDMGSNKLEQLPDTIERMQNLHTLWLQRNEITCLPQT
ISNMKNLGTLVLSNNKLQDIPVCMEEMANLRFVNFRDNPLKLKVSLPPSEGTDEEEEREL
FGLQFMHTYIQESRRRADHQVNGSTTLPISINTDG
Sequence length 335
Interactions View interactions

No strongly related genes found yet for LRRC39.

No additional diseases found yet through genes similar to LRRC39.