LRRC28 (leucine rich repeat containing 28)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Diseases linked via similar genes

Gene

• Entrez ID: 123355
• Gene name: Leucine rich repeat containing 28
• Gene symbol: LRRC28
• Synonyms (NCBI Gene): -
• Chromosome: 15
• Chromosome location: 15q26.3

miRNA Show/Hide all (42)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047396	hsa-miR-34a-5p	CLASH	23622248
MIRT733767	hsa-miR-218-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33417267
MIRT1119424	hsa-miR-1185	CLIP-seq
MIRT1119425	hsa-miR-1269	CLIP-seq
MIRT1119426	hsa-miR-1269b	CLIP-seq
MIRT1119427	hsa-miR-1275	CLIP-seq
MIRT1119428	hsa-miR-1287	CLIP-seq
MIRT1119429	hsa-miR-1288	CLIP-seq
MIRT1119430	hsa-miR-199a-5p	CLIP-seq
MIRT1119431	hsa-miR-199b-5p	CLIP-seq
MIRT1119432	hsa-miR-2355-5p	CLIP-seq
MIRT1119433	hsa-miR-3064-5p	CLIP-seq
MIRT1119434	hsa-miR-3652	CLIP-seq
MIRT1119435	hsa-miR-3679-5p	CLIP-seq
MIRT1119436	hsa-miR-378	CLIP-seq
MIRT1119437	hsa-miR-378b	CLIP-seq
MIRT1119438	hsa-miR-378c	CLIP-seq
MIRT1119439	hsa-miR-378d	CLIP-seq
MIRT1119440	hsa-miR-378e	CLIP-seq
MIRT1119441	hsa-miR-378f	CLIP-seq
MIRT1119442	hsa-miR-378h	CLIP-seq
MIRT1119443	hsa-miR-378i	CLIP-seq
MIRT1119444	hsa-miR-422a	CLIP-seq
MIRT1119445	hsa-miR-4260	CLIP-seq
MIRT1119446	hsa-miR-4320	CLIP-seq
MIRT1119447	hsa-miR-4430	CLIP-seq
MIRT1119448	hsa-miR-4505	CLIP-seq
MIRT1119449	hsa-miR-4515	CLIP-seq
MIRT1119450	hsa-miR-4525	CLIP-seq
MIRT1119451	hsa-miR-4665-5p	CLIP-seq
MIRT1119452	hsa-miR-4723-5p	CLIP-seq
MIRT1119453	hsa-miR-4740-5p	CLIP-seq
MIRT1119454	hsa-miR-4775	CLIP-seq
MIRT1119455	hsa-miR-625	CLIP-seq
MIRT1119456	hsa-miR-892b	CLIP-seq
MIRT2033751	hsa-miR-3202	CLIP-seq
MIRT2033752	hsa-miR-3910	CLIP-seq
MIRT2033753	hsa-miR-4271	CLIP-seq
MIRT2033754	hsa-miR-4493	CLIP-seq
MIRT2033755	hsa-miR-4725-3p	CLIP-seq
MIRT2033756	hsa-miR-4747-5p	CLIP-seq
MIRT1119455	hsa-miR-625	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0035556	Process	Intracellular signal transduction	IBA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q86X40
• Protein name: Leucine-rich repeat-containing protein 28
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13855	LRR_8	41 → 100	Leucine rich repeat	Repeat
  PF13855	LRR_8	111 → 169	Leucine rich repeat	Repeat
  PF13855	LRR_8	17 → 77	Leucine rich repeat	Repeat

• Sequence:

  MASELCKTISVARLEKHKNLFLNYRNLHHFPLELLKDEGLQYLERLYMKRNSLTSLPENL
  AQKLPNLVELYLHSNNIVVVPEAIGSLVKLQCLDLSDNALEIVCPEIGRLRALRHLRLAN
  NQLQFLPPEVGDLKELQTLDISTNRLLTLPERLHMCLSLQYLTVDRNRLWYVPRHLCQLP
  SLNELSMAGNRLAFLPLDLGRSRELQYVYVDNNIHLKGLPSYLYNKVIGCSGCGAPIQVS
  EVKLLSFSSGQRTVFLPAEVKAIGTEHDHVLPLQELAMRGLYHTYHSLLKDLNFLSPISL
  PRSLLELLHCPLGHCHRCSEPMFTIVYPKLFPLRETPMAGLHQWKTTVSFVAYCCSTQCL
  QTFDLLS

• Sequence length: 367

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
DENTAL CARIES	—	GWAS catalog	31533690	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACHADO-JOSEPH DISEASE	—	GWAS catalog	32205469	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinogenesis	Carcinogenesis	Pubtator	23045723	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23045723		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23045723	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17786358		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for LRRC28.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to LRRC28.