LRRC26 (leucine rich repeat containing 26)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 389816
• Gene name: Leucine rich repeat containing 26
• Gene symbol: LRRC26
• Synonyms (NCBI Gene): CAPC, bA350O14.10
• Chromosome: 9
• Chromosome location: 9q34.3

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005249	Function	Voltage-gated potassium channel activity	IBA
GO:0005249	Function	Voltage-gated potassium channel activity	IDA	22547800
GO:0005515	Function	Protein binding	IPI	20613726
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	22547800
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	IBA
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	20613726, 22547800
GO:0008076	Component	Voltage-gated potassium channel complex	IEA
GO:0015459	Function	Potassium channel regulator activity	IDA	20613726
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0044325	Function	Transmembrane transporter binding	IBA
GO:0044325	Function	Transmembrane transporter binding	IEA
GO:0044325	Function	Transmembrane transporter binding	IPI	22547800
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0071805	Process	Potassium ion transmembrane transport	IDA	22547800
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0099104	Function	Potassium channel activator activity	IBA
GO:0099104	Function	Potassium channel activator activity	IDA	22547800
GO:0099104	Function	Potassium channel activator activity	IEA
GO:1903818	Process	Positive regulation of voltage-gated potassium channel activity	IDA	22547800

Other IDs

• MIM: 613505
• HGNC: 31409
• e!Ensembl: ENSG00000184709

Protein

• UniProt ID: Q2I0M4
• Protein name: Leucine-rich repeat-containing protein 26 (BK channel auxiliary gamma subunit LRRC26) (Cytokeratin-associated protein in cancer)
• Protein function: Auxiliary protein of the large-conductance, voltage and calcium-activated potassium channel (BK alpha). Required for the conversion of BK alpha channels from a high-voltage to a low-voltage activated channel type in non-excitable cells. These ar
• PDB: 7YNZ , 7YO0 , 7YO1 , 7YO3 , 7YO4 , 8VAV , 8VAZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13855	LRR_8	72 → 131	Leucine rich repeat	Repeat
  PF13855	LRR_8	95 → 155	Leucine rich repeat	Repeat
  PF13855	LRR_8	143 → 202	Leucine rich repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 is expressed highly in normal prostate and salivary gland, very weakly in colon, pancreas, and intestine, and not at all in other tissues. Isoform 1 is expressed highly in many cancer cell lines and in breast cancer, pancreat
• Sequence:

  MRGPSWSRPRPLLLLLLLLSPWPVWAQVSATASPSGSLGAPDCPEVCTCVPGGLASCSAL
  SLPAVPPGLSLRLRALLLDHNRVRALPPGAFAGAGALQRLDLRENGLHSVHVRAFWGLGA
  LQLLDLSANQLEALAPGTFAPLRALRNLSLAGNRLARLEPAALGALPLLRSLSLQDNELA
  ALAPGLLGRLPALDALHLRGNPWGCGCALRPLCAWLRRHPLPASEAETVLCVWPGRLTLS
  PLTAFSDAAFSHCAQPLALRDLAVVYTLGPASFLVSLASCLALGSGLTACRARRRRLRTA
  ALRPPRPPDPNPDPDPHGCASPADPGSPAAAAQA

• Sequence length: 334

Related Genes

No strongly related genes found yet for LRRC26.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to LRRC26.