Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	122769
Gene name	Leucine rich repeat protein 1
Gene symbol	LRR1
Synonyms (NCBI Gene)	4-1BBLRRLRR-1PPIL5
Chromosome	14
Chromosome location	14q21.3
Summary	The protein encoded by this gene contains a leucine-rich repeat (LRR). It specifically interacts with TNFRSF9/4-1BB, a member of the tumor necrosis factor receptor (TNFR) superfamily. Overexpression of this gene suppresses the activation of NF-kappa B ind

45 Show/Hide all (45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016279	hsa-miR-193b-3p	Microarray	20304954
MIRT042562	hsa-miR-423-3p	CLASH	23622248
MIRT1118697	hsa-miR-1284	CLIP-seq
MIRT1118698	hsa-miR-1289	CLIP-seq
MIRT1118699	hsa-miR-204	CLIP-seq
MIRT1118700	hsa-miR-211	CLIP-seq
MIRT1118701	hsa-miR-3183	CLIP-seq
MIRT1118702	hsa-miR-3198	CLIP-seq
MIRT1118703	hsa-miR-338-3p	CLIP-seq
MIRT1118704	hsa-miR-3646	CLIP-seq
MIRT1118705	hsa-miR-3925-3p	CLIP-seq
MIRT1118706	hsa-miR-4294	CLIP-seq
MIRT1118707	hsa-miR-4309	CLIP-seq
MIRT1118708	hsa-miR-4530	CLIP-seq
MIRT1118709	hsa-miR-4643	CLIP-seq
MIRT1118710	hsa-miR-466	CLIP-seq
MIRT1118711	hsa-miR-4691-5p	CLIP-seq
MIRT1118712	hsa-miR-4723-3p	CLIP-seq
MIRT1118713	hsa-miR-4755-5p	CLIP-seq
MIRT1118714	hsa-miR-4789-3p	CLIP-seq
MIRT1118715	hsa-miR-4789-5p	CLIP-seq
MIRT1118716	hsa-miR-4799-5p	CLIP-seq
MIRT1118717	hsa-miR-623	CLIP-seq
MIRT1118718	hsa-miR-766	CLIP-seq
MIRT1118699	hsa-miR-204	CLIP-seq
MIRT1118700	hsa-miR-211	CLIP-seq
MIRT2264005	hsa-miR-3145-5p	CLIP-seq
MIRT1118713	hsa-miR-4755-5p	CLIP-seq
MIRT2264006	hsa-miR-508-5p	CLIP-seq
MIRT2264007	hsa-miR-550b	CLIP-seq
MIRT1118717	hsa-miR-623	CLIP-seq
MIRT1118697	hsa-miR-1284	CLIP-seq
MIRT1118701	hsa-miR-3183	CLIP-seq
MIRT1118705	hsa-miR-3925-3p	CLIP-seq
MIRT1118709	hsa-miR-4643	CLIP-seq
MIRT1118710	hsa-miR-466	CLIP-seq
MIRT1118711	hsa-miR-4691-5p	CLIP-seq
MIRT1118712	hsa-miR-4723-3p	CLIP-seq
MIRT1118714	hsa-miR-4789-3p	CLIP-seq
MIRT1118715	hsa-miR-4789-5p	CLIP-seq
MIRT1118718	hsa-miR-766	CLIP-seq
MIRT2684176	hsa-miR-485-3p	CLIP-seq
MIRT2684177	hsa-miR-487a	CLIP-seq
MIRT2684178	hsa-miR-501-3p	CLIP-seq
MIRT2684179	hsa-miR-502-3p	CLIP-seq

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0016567	Process	Protein ubiquitination	IEA
GO:0035556	Process	Intracellular signal transduction	IBA

MIM	HGNC	e!Ensembl
609193	19742	ENSG00000165501

Q96L50

Protein name

Leucine-rich repeat protein 1 (4-1BB-mediated-signaling molecule) (4-1BBlrr) (LRR-repeat protein 1) (LRR-1) (Peptidylprolyl isomerase-like 5)

Protein function

Substrate recognition subunit of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:15601820). ECS(LRR1) ubiquitinat

PDB

7PLO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12799	LRR_4	177 → 220	Leucine Rich repeats (2 copies)	Repeat

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Maximal expression was seen in the heart and skeletal muscle and minimal expression seen in the kidney.

Sequence

MKLHCEVEVISRHLPALGLRNRGKGVRAVLSLCQQTSRSQPPVRAFLLISTLKDKRGTRY
ELRENIEQFFTKFVDEGKATVRLKEPPVDICLSKAISSSLKGFLSAMRLAHRGCNVDTPV
STLTPVKTSEFENFKTKMVITSKKDYPLSKNFPYSLEHLQTSYCGLVRVDMRMLCLKSLR
KLDLSHNHIKKLPATIGDLIHLQELNLNDNHLESFSVALCHSTLQKSLRSLDLSKNKIKA
LPVQFCQLQELKNLKLDDNELIQFPCKIGQLINLRFLSAARNKLPFLPSEFRNLSLEYLD
LFGNTFEQPKVLPVIKLQAPLTLLESSARTILHNRIPYGSHIIPFHLCQDLDTAKICVCG
RFCLNSFIQGTTTMNLHSVAHTVVLVDNLGGTEAPIISYFCSLGCYVNSSDMLK

Sequence length

414

Interactions

View interactions

Reactome Pathway
Neddylation
Antigen processing: Ubiquitination & Proteasome degradation

Related Genes Genes most often co-reported with LRR1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for LRR1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to LRR1 (see Related Genes above), that are NOT already directly curated for LRR1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to LRR1.

LRR1 (leucine rich repeat protein 1)

Bookmark This Gene