LRCOL1 (leucine rich colipase like 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100507055
Gene name Leucine rich colipase like 1
Gene symbol LRCOL1
Synonyms (NCBI Gene)
-
Chromosome 12
Chromosome location 12q24.33
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0007586 Process Digestion IEA
GO:0008047 Function Enzyme activator activity IEA
GO:0016042 Process Lipid catabolic process IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NCL2
Protein name Leucine-rich colipase-like protein 1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15083 Colipase-like 66 → 153 Colipase-like Family
PF15083 Colipase-like 27 → 80 Colipase-like Family
Sequence 
MAGPGWTLLLLLLLLLLLGSMAGYGPQKKLNLSHKGIGEPCRRHEECQSNCCTINSLAPH
TLCTPKTIFLQCLPWRKPNGYRCSHDSECQSSCCVRNNSPQELCTPQSVFLQCVPWRKPN
GDFCSSHQECHSQCCIQLREYSPFRCIPRTGILAQCLPL
Sequence length 159
Interactions View interactions

No strongly related genes found yet for LRCOL1.

No additional diseases found yet through genes similar to LRCOL1.