LPAL2 (lipoprotein(a) like 2 (pseudogene))

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 80350
Gene name Lipoprotein(a) like 2 (pseudogene)
Gene symbol LPAL2
Synonyms (NCBI Gene)
APOA2APOALAPOARGCapo(a)rg-C
Chromosome 6
Chromosome location 6q25.3
Summary Apolipoprotein(a) is the distinguishing protein moiety of lipoprotein(a), of which elevated plasma levels are correlated with an increased risk of atherosclerosis. This gene is similar to the lipoprotein, Lp(a) gene, but all transcripts produced by this g
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT016940 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32814053
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
611682 21210 ENSG00000290613
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16609
Protein name Putative apolipoprotein(a)-like protein 2 (Apo(a)-like protein 2) (Lp(a)-liker protein 2) (Apolipoprotein a-related gene C protein) (Apo(a)rg-C)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00051 Kringle 28 → 105 Kringle domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in liver but not in other tissues tested. {ECO:0000269|PubMed:7749817}.
Sequence 
MEHKEVVLLLLLFLKSAPTETGPSVQECYHSNGQSYRGTYFTTVTGRTCQAWSSMTPHQH
SRTPEKYPNDGLISNYCRNPDCSAGPWCYTTDPNVRWEYCNLTRCSDDEGTVFVPLTVIP
VPSLEDSFIQVA
Sequence length 132
Interactions View interactions

No strongly related genes found yet for LPAL2.

No additional diseases found yet through genes similar to LPAL2.