LOC100533997 (-)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 100533997 |
| Gene name | - |
| Gene symbol | LOC100533997 |
| Synonyms (NCBI Gene) |
CT1.5MAGEA10-MAGEA5MAGEA5P
|
| Chromosome | X |
| Chromosome location | Xq28 |
|
miRNA
miRNA information provided by mirtarbase database.
17
|
|||||||||||||||||||||||||
|
|||||||||||||||||||||||||
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
|
|||||||||||
|
|||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|||||||||||
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
P43359 | ||||||||||
| Protein name | Putative melanoma-associated antigen 5P (Cancer/testis antigen 1.5) (CT1.5) (MAGE family member A5 pseudogene) (MAGE-5 antigen) | ||||||||||
| Protein function | May negatively regulates apoptosis. | ||||||||||
| Family and domains |
Pfam
|
||||||||||
| Tissue specificity | TISSUE SPECIFICITY: Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes. | ||||||||||
| Sequence |
MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTLGEVPAAGSPG |
||||||||||
| Sequence length | 124 | ||||||||||
| Interactions | View interactions | ||||||||||
|
Related Genes
Genes most often co-reported with LOC100533997 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to LOC100533997 (see Related Genes above), that are NOT already directly curated for LOC100533997 itself -- a lead worth checking, not a confirmed association.
0
|
|