LNP1 (leukemia NUP98 fusion partner 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 348801
Gene name Leukemia NUP98 fusion partner 1
Gene symbol LNP1
Synonyms (NCBI Gene)
NP3
Chromosome 3
Chromosome location 3q12.2
miRNA miRNA information provided by mirtarbase database.
6 Show/Hide all (6)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1112413 hsa-miR-1253 CLIP-seq
MIRT1112414 hsa-miR-1305 CLIP-seq
MIRT1112415 hsa-miR-296-3p CLIP-seq
MIRT1112416 hsa-miR-3154 CLIP-seq
MIRT1112417 hsa-miR-3671 CLIP-seq
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A1A4G5
Protein name Leukemia NUP98 fusion partner 1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15419 LNP1 7 → 175 Leukemia NUP98 fusion partner 1 Family
Sequence 
MEHKDDDDDDVSFAKWMSSFWGHSWREEDQRGLRERHRLQATSHRKTSLPCPLPVLPRIP
SSDCHPRRHSHEDQEFRCRSHVRDYRKYSEDGSFKEPLESKGRSHSKIEKFSESFERQLC
FRTKRSASLGPESRKERNERECLRMEIKSRKKVEEERSSRKEEHGEAHMAPLFEKGPE
Sequence length 178
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Neurodevelopmental disorder with epilepsy and hypoplasia of the corpus callosum Benign ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations

No strongly related genes found yet for LNP1.

No additional diseases found yet through genes similar to LNP1.