LLCFC1 (LLLL and CFNLAS motif containing 1)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 135927
Gene name LLLL and CFNLAS motif containing 1
Gene symbol LLCFC1
Synonyms (NCBI Gene)
C7orf34SOF1ctm-1
Chromosome 7
Chromosome location 7q34
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0007338 Process Single fertilization IEA
GO:0007342 Process Fusion of sperm to egg plasma membrane involved in single fertilization IBA
GO:0007342 Process Fusion of sperm to egg plasma membrane involved in single fertilization IEA
GO:0007342 Process Fusion of sperm to egg plasma membrane involved in single fertilization ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
618946 21750 ENSG00000165131
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96L11
Protein name Sperm-egg fusion protein LLCFC1 (LLLL and CFNLAS motif-containing protein 1) (MSSP-binding protein CTM-1) (Sperm-oocyte fusion required protein 1)
Protein function Sperm protein required for fusion of sperm with the egg membrane during fertilization.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15838 DUF4717 31 → 102 Domain of unknown function (DUF4717) Family
Sequence 
MPPLAPQLCRAVFLVPILLLLQVKPLNGSPGPKDGSQTEKTPSADQNQEQFEEHFVASSV
GEMWQVVDMAQQEEDQSSKTAAVHKHSFHLSFCFSLASVMVFSGGPLRRTFPNIQLCFML
TH
Sequence length 122
Interactions View interactions

No strongly related genes found yet for LLCFC1.

No additional diseases found yet through genes similar to LLCFC1.