Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	340654
Gene name	Lipase family member M
Gene symbol	LIPM
Synonyms (NCBI Gene)	LIPL3bA304I5.1
Chromosome	10
Chromosome location	10q23.31

12 Show/Hide all (12)

GO ID	Ontology	Definition	Evidence
GO:0004465	Function	Lipoprotein lipase activity	TAS
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0006629	Process	Lipid metabolic process	IBA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016298	Function	Lipase activity	IBA
GO:0016298	Function	Lipase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016788	Function	Hydrolase activity, acting on ester bonds	IEA
GO:0052689	Function	Carboxylic ester hydrolase activity	IEA
GO:0070268	Process	Cornification	TAS

MIM	HGNC	e!Ensembl
613923	23455	ENSG00000173239

Q5VYY2

Protein name

Lipase member M (EC 3.1.1.-) (Lipase-like abhydrolase domain-containing protein 3)

Protein function

Plays a highly specific role in the last step of keratinocyte differentiation. May have an essential function in lipid metabolism of the most differentiated epidermal layers.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04083	Abhydro_lipase	49 → 111	Partial alpha/beta-hydrolase lipase region	Family

Tissue specificity

TISSUE SPECIFICITY: Exclusively expressed in the epidermis within the granular keratinocytes. {ECO:0000269|PubMed:17562024}.

Sequence

MLETLSRQWIVSHRMEMWLLILVAYMFQRNVNSVHMPTKAVDPEAFMNISEIIQHQGYPC
EEYEVATEDGYILSVNRIPRGLVQPKKTGSRPVVLLQHGLVGGASNWISNLPNNSLGFIL
ADAGFDVWMGNSRGNAWSRKHKTLSIDQDEFWAFSYDEMARFDLPAVINFILQKTGQEKI
YYVGYSQGTTMGFIAFSTMPELAQKIKMYFALAPIATVKHAKSPGTKFLLLPDMMIKGLF
GKKEFLYQTRFLRQLVIYLCGQVILDQICSNIMLLLGGFNTNNMNMSRASVYAAHTLAGT
SVQNILHWSQAVNSGELRAFDWGSETKNLEKCNQPTPVRYRVRDMTVPTAMWTGGQDWLS
NPEDVKMLLSEVTNLIYHKNIPEWAHVDFIWGLDAPHRMYNEIIHLMQQEETNLSQGRCE
AVL

Sequence length

423

Interactions

View interactions

Reactome Pathway
Formation of the cornified envelope

Related Genes Genes most often co-reported with LIPM across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for LIPM.

Diseases Linked via Similar Genes Diseases curated for genes most similar to LIPM (see Related Genes above), that are NOT already directly curated for LIPM itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to LIPM.

LIPM (lipase family member M)

Bookmark This Gene