LINGO3 (leucine rich repeat and Ig domain containing 3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 645191
Gene name Leucine rich repeat and Ig domain containing 3
Gene symbol LINGO3
Synonyms (NCBI Gene)
LERN2LRRN6B
Chromosome 19
Chromosome location 19p13.3
miRNA miRNA information provided by mirtarbase database.
31 Show/Hide all (31)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018012 hsa-miR-335-5p Microarray 18185580
MIRT487157 hsa-miR-149-3p PAR-CLIP 23592263
MIRT487156 hsa-miR-4728-5p PAR-CLIP 23592263
MIRT487155 hsa-miR-6785-5p PAR-CLIP 23592263
MIRT487154 hsa-miR-6883-5p PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane IBA
GO:0016020 Component Membrane IEA
GO:0038023 Function Signaling receptor activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
609792 21206 ENSG00000220008
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0C6S8
Protein name Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 (Leucine-rich repeat neuronal protein 2) (Leucine-rich repeat neuronal protein 6B)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 54 → 114 Leucine rich repeat Repeat
PF13855 LRR_8 104 → 162 Leucine rich repeat Repeat
PF13855 LRR_8 246 → 306 Leucine rich repeat Repeat
PF13855 LRR_8 295 → 354 Leucine rich repeat Repeat
PF13855 LRR_8 150 → 207 Leucine rich repeat Repeat
PF13855 LRR_8 44 → 90 Leucine rich repeat Repeat
PF13927 Ig_3 406 → 484 Domain
Sequence 
MTCWLCVLSLPLLLLPAAPPPAGGCPARCECTVQTRAVACTRRRLTAVPDGIPAETRLLE
LSRNRIRCLNPGDLAALPALEELDLSENAIAHVEPGAFANLPRLRVLRLRGNQLKLIPPG
VFTRLDNLTLLDLSENKLVILLDYTFQDLHSLRRLEVGDNDLVFVSRRAFAGLLALEELT
LERCNLTALSGESLGHLRSLGALRLRHLAIASLEDQNFRRLPGLLHLEIDNWPLLEEVAA
GSLRGLNLTSLSVTHTNITAVPAAALRHQAHLTCLNLSHNPISTVPRGSFRDLVRLRELH
LAGALLAVVEPQAFLGLRQIRLLNLSNNLLSTLEESTFHSVNTLETLRVDGNPLACDCRL
LWIVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQRVTAT
AGEDVRFLCRAEGEPAPTVAWVTPQHRPVTATSAGRARVLPGGTLEIQDARPQDSGTYTC
VASNAGGNDTYFATLTVRPEPAANRTPGEAHNETLAALRAPLDLTTILVSTAMGCITFLG
VVLFCFVLLFVWSRGRGQHKNNFSVEYSFRKVDGPAAAAGQGGARKFNMKMI
Sequence length 592
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Myoepithelial tumor Uncertain significance ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Asphyxia Asphyxia Pubtator 38191519 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 29377892 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Colitis Colitis Pubtator 33941035 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for LINGO3.

No additional diseases found yet through genes similar to LINGO3.