LINC02914 (long intergenic non-protein coding RNA 2914)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 283598
Gene name Long intergenic non-protein coding RNA 2914
Gene symbol LINC02914
Synonyms (NCBI Gene)
C14orf177
Chromosome 14
Chromosome location 14q32.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005929 Component Cilium IEA
GO:0031514 Component Motile cilium IEA
GO:0042995 Component Cell projection IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q52M58
Protein name Testis-specific protein LINC02914 (Long intergenic non-protein coding RNA 2914)
Protein function May play a role in the flagellum biology.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17698 DUF5544 1 → 125 Family
Tissue specificity TISSUE SPECIFICITY: Expressed in testes and ejaculated spermatozoa (at protein level). {ECO:0000269|PubMed:28891297}.
Sequence 
MHRKEPGARLEATRGAARPHKQGTKPMITRPSVSQLGEGKCPSSQHLQSLRHNKQHALTL
TKARCCGECSTCFCTEEKSECQRHEETSPGSCNHQIMSASTISAFCATPRFKQLFKGTVE
QMSQM
Sequence length 125
Interactions View interactions

No strongly related genes found yet for LINC02914.

No additional diseases found yet through genes similar to LINC02914.