LINC02913 (long intergenic non-protein coding RNA 2913)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 414318
Gene name Long intergenic non-protein coding RNA 2913
Gene symbol LINC02913
Synonyms (NCBI Gene)
C9orf106
Chromosome 9
Chromosome location 9q34.11
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 28514442, 33961781
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 31370 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NAJ2
Protein name Putative uncharacterized protein encoded by LINC02913
Family and domains
Sequence 
MAYVALSDKPHLSGEVGEEACSSWNPPLFSPRPLPRLWPLPGTPFLPIRALPFSASSSGK
SSLVPSPSSSAHSGFRTPCLGPDCLLCTQGCELHEGRNHMAVHSCVARAWPGDPQEVRHL
NPLLCDPGSQVEPSWPWHPGLEQAAASWVGNHVSPAHRQALRGHSLGSALRALMPGRHCP
LCVPCKRGCDLRGGRGKHGPRPCCPLLRKFPVLPVHPWPFPCAVWDSGWSCR
Sequence length 232
Interactions View interactions

No strongly related genes found yet for LINC02913.

No additional diseases found yet through genes similar to LINC02913.