LINC02881 (long intergenic non-protein coding RNA 2881)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100130539
Gene name Long intergenic non-protein coding RNA 2881
Gene symbol LINC02881
Synonyms (NCBI Gene)
C10orf142
Chromosome 10
Chromosome location 10q11.21
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 51236 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
B7Z368
Protein name Uncharacterized protein encoded by LINC02881 (Long intergenic non-protein coding RNA 2881)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17713 DUF5558 1 → 126 Family
Sequence 
MRMYSSDAHERPPSPSLGTTPPHPLPPTGSPRPRQDSAAGNSEEREPRGLRRASGVGSSC
KRPTVCMGRQQGLPFCTVCGYRCSSPERTRGRCAVGKVRVAGGGGAPGGGAGMRCCGCRE
RNINKELELF
Sequence length 130
Interactions View interactions

No strongly related genes found yet for LINC02881.

No additional diseases found yet through genes similar to LINC02881.