LINC01587 (long intergenic non-protein coding RNA 1587)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 10141 |
| Gene name | Long intergenic non-protein coding RNA 1587 |
| Gene symbol | LINC01587 |
| Synonyms (NCBI Gene) |
C4orf6aC1
|
| Chromosome | 4 |
| Chromosome location | 4p16.2 |
| Summary | This gene is expressed in neuroblastoma; however, the function of this gene is not yet determined. [provided by RefSeq, Jul 2008] |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
|
|||||||||||
|
|||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q99440 |
| Protein name | Uncharacterized protein encoded by LINC01587 (Protein AC1) |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Expressed in neuroblastoma. |
| Sequence |
MDTQKQIHKTHNSKNQFFTIFFFLSVEFGKEGTRKNFYLLLSIGHYGRKSRRADLGTADT |
| Sequence length | 93 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with LINC01587 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to LINC01587 (see Related Genes above), that are NOT already directly curated for LINC01587 itself -- a lead worth checking, not a confirmed association.
0
|
|