LINC01565 (long intergenic non-protein coding RNA 1565)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 23434
Gene name Long intergenic non-protein coding RNA 1565
Gene symbol LINC01565
Synonyms (NCBI Gene)
C3orf27GR6
Chromosome 3
Chromosome location 3q21.3
miRNA miRNA information provided by mirtarbase database.
13 Show/Hide all (13)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT742403 hsa-miR-15b-5p HITS-CLIP 23824327
MIRT742404 hsa-miR-424-5p HITS-CLIP 23824327
MIRT742405 hsa-miR-16-5p HITS-CLIP 23824327
MIRT742406 hsa-miR-6838-5p HITS-CLIP 23824327
MIRT742407 hsa-miR-15a-5p HITS-CLIP 23824327
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
618259 17099 ENSG00000198685
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O15544
Protein name Protein GR6
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in fetus (aged from 7 to 8 weeks). Weakly expressed in lymphocytes. {ECO:0000269|PubMed:9307271}.
Sequence 
MKEALHQIVVRCSELVSSTSLPRLSVSRLQGPPDSQPLGTLGQGGWKLLGIVGSLAPETL
GGLGTEFGPCTHPLPFDMVRERERDDELRQGWLLQCPQCARTLLCHCGPFLTPPSQTSSS
GFQLCSLKPSGSLVTATEPLSNFAFSYFP
Sequence length 149
Interactions View interactions

No strongly related genes found yet for LINC01565.

No additional diseases found yet through genes similar to LINC01565.