LINC01559 (long intergenic non-protein coding RNA 1559)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 283422 |
| Gene name | Long intergenic non-protein coding RNA 1559 |
| Gene symbol | LINC01559 |
| Synonyms (NCBI Gene) |
C12orf36
|
| Chromosome | 12 |
| Chromosome location | 12p13.1 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q495D7 |
| Protein name | Putative uncharacterized protein encoded by LINC01559 |
| Family and domains | |
| Sequence |
MERFLNSKARRLGSCSHPAFYLLCVPDEDTSCSTIYLPLKRRADPDQLFSDLLGGTQRLW |
| Sequence length | 138 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with LINC01559 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to LINC01559 (see Related Genes above), that are NOT already directly curated for LINC01559 itself -- a lead worth checking, not a confirmed association.
0
|
|