LINC01554 (long intergenic non-protein coding RNA 1554)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 202299
Gene name Long intergenic non-protein coding RNA 1554
Gene symbol LINC01554
Synonyms (NCBI Gene)
C5orf27FIS
Chromosome 5
Chromosome location 5q15
miRNA miRNA information provided by mirtarbase database.
8 Show/Hide all (8)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT755055 hsa-miR-4716-3p PAR-CLIP 23592263
MIRT755056 hsa-miR-6794-5p PAR-CLIP 23592263
MIRT755057 hsa-miR-1226-3p PAR-CLIP 23592263
MIRT755058 hsa-miR-4733-3p PAR-CLIP 23592263
MIRT755059 hsa-miR-125a-3p PAR-CLIP 23592263
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q52M75
Protein name Putative uncharacterized protein encoded by LINC01554 (Protein FIS)
Family and domains
Sequence 
MTPCLESFCQRAKDCKQNIPLPFLIQDWPLSESKPQGQDFWTPQPLQAAAPSHEFQQVAL
HPARTRLASRPQGGRLMSSREVGLRAPRCSCGKRKR
Sequence length 96
Interactions View interactions

No strongly related genes found yet for LINC01554.

No additional diseases found yet through genes similar to LINC01554.