LINC01553 (long intergenic non-protein coding RNA 1553)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 283025
Gene name Long intergenic non-protein coding RNA 1553
Gene symbol LINC01553
Synonyms (NCBI Gene)
C10orf40
Chromosome 10
Chromosome location 10q21.2
miRNA miRNA information provided by mirtarbase database.
9 Show/Hide all (9)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT754276 hsa-miR-154-5p PAR-CLIP 21572407
MIRT754277 hsa-miR-5011-5p PAR-CLIP 21572407
MIRT754278 hsa-miR-511-3p PAR-CLIP 21572407
MIRT754279 hsa-miR-3177-5p PAR-CLIP 21572407
MIRT754280 hsa-miR-6867-5p PAR-CLIP 21572407
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A4QN01
Protein name Putative uncharacterized protein encoded by LINC01553
Family and domains
Sequence 
MKHKYNTLSWYKKERSTQLRRFIVHQPEVGLFFFLRDVVYNYITEKTTCRCPLTQERPCD
TGGKFGRIWICQPEELGKMQIWICQPEELGKMQIDKNRTMVQQMWYIWYGGLDTSTNSLL
PILVRGMA
Sequence length 128
Interactions View interactions

No strongly related genes found yet for LINC01553.

No additional diseases found yet through genes similar to LINC01553.