LINC00526 (long intergenic non-protein coding RNA 526)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 147525
Gene name Long intergenic non-protein coding RNA 526
Gene symbol LINC00526
Synonyms (NCBI Gene)
C18orf18HsT959TP53LC13
Chromosome 18
Chromosome location 18p11.31
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 28278 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96FQ7
Protein name Putative uncharacterized protein encoded by LINC00526
Family and domains
Sequence 
MSHSYKKAISDEALRPFQMDYFGGLPPGQYATRMTGQVHGSGCHLRSAPCDLGASQRKLS
SNFSEIDAGLFSQGKSAAYTDIGATKPVEQRETAS
Sequence length 95
Interactions View interactions

No strongly related genes found yet for LINC00526.

No additional diseases found yet through genes similar to LINC00526.