LINC00523 (long intergenic non-protein coding RNA 523)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 283601 |
| Gene name | Long intergenic non-protein coding RNA 523 |
| Gene symbol | LINC00523 |
| Synonyms (NCBI Gene) |
C14orf70
|
| Chromosome | 14 |
| Chromosome location | 14q32.2 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q86TU6 |
| Protein name | Putative uncharacterized protein encoded by LINC00523 |
| Family and domains | |
| Sequence |
MGIGTGHTSMNKGGKDVTLLELSVEKRRWRINMETSKIILEKMQSDDVLDGNRERSNERE |
| Sequence length | 105 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with LINC00523 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to LINC00523 (see Related Genes above), that are NOT already directly curated for LINC00523 itself -- a lead worth checking, not a confirmed association.
0
|
|