LINC00482 (long intergenic non-protein coding RNA 482)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 284185
Gene name Long intergenic non-protein coding RNA 482
Gene symbol LINC00482
Synonyms (NCBI Gene)
C17orf55
Chromosome 17
Chromosome location 17q25.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 26816 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N8I6
Protein name Putative uncharacterized protein encoded by LINC00482
Family and domains
Sequence 
MPRSLKRAQLRSLLPRPPAVSHTQPWYRAAHPTTSPTAASRDVHPASGAVPGPWLVEGTA
VREGPQLQDAVPQRPTRPSKALWPAQMSAAPAIRLGQMVPGDTRGLWGPQGTLLTWTYRG
GQGGRWTRRAEGPREGTFAEQRPHFQSSGAQQESRLAMGPPPLGLGDAAGDGRGQTGQEK
GRAEGRQARKSACKCPRKGPNPGPWTRAAAWWGRLEGAKASAKGEQVRDPGGHLWEQGHV
SPCARFNQGHSCGSPKVSHTTWVS
Sequence length 264
Interactions View interactions

No strongly related genes found yet for LINC00482.

No additional diseases found yet through genes similar to LINC00482.