LINC00472 (long intergenic non-protein coding RNA 472)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 79940
Gene name Long intergenic non-protein coding RNA 472
Gene symbol LINC00472
Synonyms (NCBI Gene)
C6orf155P53RRAPEXF
Chromosome 6
Chromosome location 6q13
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620059 21380 ENSG00000233237
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H8W2
Protein name Putative uncharacterized protein encoded by LINC00472
Family and domains
Sequence 
MRPGSSPRAPECGAPALPRPQLDRLPARPAPSRGRGAPSLRWPAKEVGPRPQIPATCEPG
KVCGASAGRRDAARPSRPRSSRVTFSTRRQPGPQRGRWGLRGGPESVRGLPHLGLRISGT
PLGIFSSWSL
Sequence length 130
Interactions View interactions

No strongly related genes found yet for LINC00472.

No additional diseases found yet through genes similar to LINC00472.