LINC00312 (long intergenic non-protein coding RNA 312)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 29931 |
| Gene name | Long intergenic non-protein coding RNA 312 |
| Gene symbol | LINC00312 |
| Synonyms (NCBI Gene) |
ERR-10ERR10LMCD1DNLOH3CR2ANAG-7NAG7NCRNA00312
|
| Chromosome | 3 |
| Chromosome location | 3p25.3 |
| Summary | This gene produces an intronless transcript that is thought to function as a tumor suppressor. This transcript is downregulated in nasopharyngeal carcinoma and is a negative regulator of estrogen receptor signaling. A common polymorphism in this transcrip |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q9Y6C7 |
| Protein name | Putative uncharacterized protein encoded by LINC00312 (Loss of heterozygosity 3 chromosomal region 2 gene A protein) |
| Family and domains | |
| Sequence |
MAHHSLNTFYIWHNNVLHTHLVFFLPHLLNQPFSRGSFLIWLLLCWNSWYHLRTLRRQAN |
| Sequence length | 94 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with LINC00312 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to LINC00312 (see Related Genes above), that are NOT already directly curated for LINC00312 itself -- a lead worth checking, not a confirmed association.
0
|
|