LINC00208 (long intergenic non-protein coding RNA 208)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 83655 |
| Gene name | Long intergenic non-protein coding RNA 208 |
| Gene symbol | LINC00208 |
| Synonyms (NCBI Gene) |
C8orf14NCRNA00208VIR35
|
| Chromosome | 8 |
| Chromosome location | 8p23.1 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q96KT6 |
| Protein name | Putative uncharacterized protein encoded by LINC00208 |
| Family and domains | |
| Sequence |
MGQSLQEGRKQGRLLPAPSAHFLKHAHLASPSEVGGEPEIGSLCASHVLHMSPLYSVNLQ |
| Sequence length | 92 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with LINC00208 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to LINC00208 (see Related Genes above), that are NOT already directly curated for LINC00208 itself -- a lead worth checking, not a confirmed association.
0
|
|