LINC00052 (long intergenic non-protein coding RNA 52)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 145978 |
| Gene name | Long intergenic non-protein coding RNA 52 |
| Gene symbol | LINC00052 |
| Synonyms (NCBI Gene) |
NCRNA00052TMEM83
|
| Chromosome | 15 |
| Chromosome location | 15q25.3 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
|
|||||||||||
|
|||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q96N35 |
| Protein name | Putative uncharacterized protein encoded by LINC00052 (Putative transmembrane protein 83) |
| Family and domains | |
| Sequence |
MNCDALLHHSAIPEDFLHIFLLLQKISVSLPLSLSQSVCLFYSISLCVSLLLHISLCVSV |
| Sequence length | 136 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with LINC00052 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to LINC00052 (see Related Genes above), that are NOT already directly curated for LINC00052 itself -- a lead worth checking, not a confirmed association.
0
|
|