LHFPL1 (LHFPL tetraspan subfamily member 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 340596
Gene name LHFPL tetraspan subfamily member 1
Gene symbol LHFPL1
Synonyms (NCBI Gene)
-
Chromosome X
Chromosome location Xq23
Summary This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-l
miRNA miRNA information provided by mirtarbase database.
9 Show/Hide all (9)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1108671 hsa-miR-1178 CLIP-seq
MIRT1108672 hsa-miR-1245b-3p CLIP-seq
MIRT1108673 hsa-miR-129-5p CLIP-seq
MIRT1108674 hsa-miR-3123 CLIP-seq
MIRT1108675 hsa-miR-4645-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0016020 Component Membrane IBA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300566 6587 ENSG00000182508
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86WI0
Protein name LHFPL tetraspan subfamily member 1 protein (Lipoma HMGIC fusion partner-like 1 protein)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10242 L_HMGIC_fpl 8 → 192 Lipoma HMGIC fusion partner-like protein Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed at high levels in lung, thymus, skeletal muscle, colon and ovary. {ECO:0000269|PubMed:15620218}.
Sequence 
MRSSLTMVGTLWAFLSLVTAVTSSTSYFLPYWLFGSQMGKPVSFSTFRRCNYPVRGEGHS
LIMVEECGRYASFNAIPSLAWQMCTVVTGAGCALLLLVALAAVLGCCMEELISRMMGRCM
GAAQFVGGLLISSGCALYPLGWNSPEIMQTCGNVSNQFQLGTCRLGWAYYCAGGGAAAAM
LICTWLSCFAGRNPKPVILVESIMRNTNSYAMELDHCLKP
Sequence length 220
Interactions View interactions

No strongly related genes found yet for LHFPL1.

No additional diseases found yet through genes similar to LHFPL1.