LGALS9C (galectin 9C)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 654346
• Gene name: Galectin 9C
• Gene symbol: LGALS9C
• Synonyms (NCBI Gene): Gal-9B, LGALS9B
• Chromosome: 17
• Chromosome location: 17p11.2
• Summary: This gene was initially thought to represent a pseudogene of galectin 9; however, this transcript has good exon-intron structure and encodes a predicted protein of the same size as and highly similar to galectin 9. This gene is one of two similar loci on

miRNA Show/Hide all (17)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018048	hsa-miR-335-5p	Microarray	18185580
MIRT1108325	hsa-miR-3153	CLIP-seq
MIRT1108326	hsa-miR-3199	CLIP-seq
MIRT1108327	hsa-miR-331-3p	CLIP-seq
MIRT1108328	hsa-miR-3675-5p	CLIP-seq
MIRT1108329	hsa-miR-3689a-3p	CLIP-seq
MIRT1108330	hsa-miR-3689c	CLIP-seq
MIRT1108331	hsa-miR-4283	CLIP-seq
MIRT1108332	hsa-miR-4489	CLIP-seq
MIRT1108333	hsa-miR-4652-5p	CLIP-seq
MIRT1108334	hsa-miR-4676-5p	CLIP-seq
MIRT1108335	hsa-miR-4709-3p	CLIP-seq
MIRT1108336	hsa-miR-4728-5p	CLIP-seq
MIRT1108337	hsa-miR-4740-5p	CLIP-seq
MIRT1108338	hsa-miR-575	CLIP-seq
MIRT2260817	hsa-miR-1286	CLIP-seq
MIRT2260818	hsa-miR-4757-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0010628	Process	Positive regulation of gene expression	IBA
GO:0016936	Function	Galactoside binding	IBA
GO:0030246	Function	Carbohydrate binding	IBA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0032689	Process	Negative regulation of type II interferon production	IBA
GO:2000562	Process	Negative regulation of CD4-positive, alpha-beta T cell proliferation	IBA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q6DKI2
• Protein name: Galectin-9C (Gal-9C) (Galectin-9-like protein B)
• Protein function: Binds galactosides.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00337	Gal-bind_lectin	227 → 356	Galactoside-binding lectin	Domain
  PF00337	Gal-bind_lectin	16 → 147	Galactoside-binding lectin	Domain

• Sequence:

  MAFSGCQAPYLSPAVPFSGTIQGGLQDGFQITVNGAVLSCSGTRFAVDFQTGFSGNDIAF
  HFNPRFEDGGYVVCNTRQKGTWGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFV
  QYFHRVPFHRVDTISVNGSVQLSYISFQNPRAVPVQPAFSTVPFSQPVCFPPRPRGRRQK
  PPSVRPANPAPITQTVIHTVQSASGQMFSQTPAIPPMMYPHPAYPMPFITTIPGGLYPSK
  SIILSGTVLPSAQRFHINLCSGSHIAFHMNPRFDENAVVRNTQINNSWGSEERSLPRKMP
  FVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQLTHVQT

• Sequence length: 356

Related Genes

No strongly related genes found yet for LGALS9C.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to LGALS9C.