LGALS9B (galectin 9B)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 284194
Gene name Galectin 9B
Gene symbol LGALS9B
Synonyms (NCBI Gene)
-
Chromosome 17
Chromosome location 17p11.2
Summary This gene was initially thought to represent a pseudogene of galectin 9; however, this transcript has good exon-intron structure and encodes a predicted protein of the same size as and highly similar to galectin 9. This gene is one of two similar loci on
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018762 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 29892012, 31515488, 32296183
GO:0005634 Component Nucleus IBA
GO:0005829 Component Cytosol IBA
GO:0005829 Component Cytosol IDA
GO:0010628 Process Positive regulation of gene expression IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q3B8N2
Protein name Galectin-9B (Gal-9B) (Galectin-9-like protein A)
Protein function Binds galactosides.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00337 Gal-bind_lectin 227 → 356 Galactoside-binding lectin Domain
PF00337 Gal-bind_lectin 16 → 147 Galactoside-binding lectin Domain
Sequence 
MAFSGSQAPYLSPAVPFSGTIQGGLQDGFQITVNGAVLSSSGTRFAVDFQTGFSGNDIAF
HFNPRFEDGGYVVCNTRQKGRWGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFV
QYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQK
PPSVRPANPAPITQTVIHTVQSASGQMFSQTPAIPPMMYPHPAYPMPFITTIPGGLYPSK
SIILSGTVLPSAQRFHINLCSGSHIAFHMNPRFDENAVVRNTQINNSWGSEERSLPRKMP
FVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQLTHVQT
Sequence length 356
Interactions View interactions

No strongly related genes found yet for LGALS9B.

No additional diseases found yet through genes similar to LGALS9B.