LGALS4 (galectin 4)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 3960
• Gene name: Galectin 4
• Gene symbol: LGALS4
• Synonyms (NCBI Gene): GAL4, L36LBP
• Chromosome: 19
• Chromosome location: 19q13.2
• Summary: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1108219	hsa-miR-4278	CLIP-seq
MIRT1108220	hsa-miR-4688	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
POU2F1	Activation	12391146

Gene ontology (GO) Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002780	Process	Antibacterial peptide biosynthetic process	IEA
GO:0005515	Function	Protein binding	IPI	26481311, 32296183
GO:0005615	Component	Extracellular space	IEA
GO:0005829	Component	Cytosol	TAS	9162064
GO:0005886	Component	Plasma membrane	TAS	9162064
GO:0007155	Process	Cell adhesion	TAS	9162064
GO:0016936	Function	Galactoside binding	IEA
GO:0030246	Function	Carbohydrate binding	IBA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030246	Function	Carbohydrate binding	TAS	9162064
GO:0031012	Component	Extracellular matrix	HDA	25037231
GO:0042742	Process	Defense response to bacterium	IEA

Other IDs

• MIM: 602518
• HGNC: 6565
• e!Ensembl: ENSG00000171747

Protein

• UniProt ID: P56470
• Protein name: Galectin-4 (Gal-4) (Antigen NY-CO-27) (L-36 lactose-binding protein) (L36LBP) (Lactose-binding lectin 4)
• Protein function: Galectin that binds lactose and a related range of sugars. May be involved in the assembly of adherens junctions.
• PDB: 1X50 , 4XZP , 4YLZ , 4YM0 , 4YM1 , 4YM2 , 4YM3 , 5CBL , 5DUU , 5DUV , 5DUW , 5DUX , 6WAB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00337	Gal-bind_lectin	18 → 149	Galactoside-binding lectin	Domain
  PF00337	Gal-bind_lectin	193 → 323	Galactoside-binding lectin	Domain

• Sequence:

  MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDV
  AFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNP
  FYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLP
  TMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPR
  MGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHR
  LSAFQRVDTLEIQGDVTLSYVQI

• Sequence length: 323

Related Genes

No strongly related genes found yet for LGALS4.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to LGALS4.